Diaphorina citri psyllid: psy2927


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MQKVSDQISIEELDIIYKIPHCVPLSAHHKWNFDDLLEKMWEYLKLTRIYTKPKGQLPDYQSPVVLHTDRRSIEDFCNKLHRTIAKEFKYALVWGSSVKHQPQKVGKEHVLNDEDVVQIVKKV
cccccccccHHHHHHHHccccCEEEcccccccHHHHHHHHHHHHccEEEEcccccccccccccEEEEcccccHHHHHHHHHHHHHHHccEEEEEcccccccccccccccEEccccEEEEEEcc
MQKVSDQISIEELDIIYKIPHCVPLSAHHKWNFDDLLEKMWEYLKLTRIYTKPKGQLPDYQSPVVLHTDRRSIEDFCNKLHRTIAKEFKYALVWGSSVKHQPQKVGKEHVLNDEDVVQIVKKV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQKVSDQISIEELDIIYKIPHCVPLSAHHKWNFDDLLEKMWEYLKLTRIYTKPKGQLPDYQSPVVLHTDRRSIEDFCNKLHRTIAKEFKYALVWGSSVKHQPQKVGKEHVLNDEDVVQIVKKV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Developmentally-regulated GTP-binding protein 1 Critical regulator of cell growth under specific conditions. Implicated in differentiation and cell cycle arrest.confidentQ3MHP5
Developmentally-regulated GTP-binding protein 1 Critical regulator of cell growth under specific conditions. Implicated in differentiation and cell cycle arrest.confidentQ9Y295
Developmentally-regulated GTP-binding protein 1 Critical regulator of cell growth under specific conditions. Implicated in differentiation and cell cycle arrest.confidentP32233

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045111 [CC]intermediate filament cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003924 [MF]GTPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0019003 [MF]GDP bindingprobableGO:0043168, GO:0017076, GO:0019001, GO:0097159, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032561, GO:0003674, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008134 [MF]transcription factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0040007 [BP]growthprobableGO:0008150
GO:0042788 [CC]polysomal ribosomeprobableGO:0005737, GO:0005844, GO:0032991, GO:0005840, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EKI, chain A
Confidence level:very confident
Coverage over the Query: 41-122
View the alignment between query and template
View the model in PyMOL
Template: 4A9A, chain A
Confidence level:very confident
Coverage over the Query: 1-122
View the alignment between query and template
View the model in PyMOL