Psyllid ID: psy2927
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 123 | ||||||
| 156542821 | 367 | PREDICTED: GTP-binding protein 128up-lik | 0.959 | 0.321 | 0.898 | 4e-60 | |
| 242023708 | 367 | GTP-binding protein 128up, putative [Ped | 0.959 | 0.321 | 0.898 | 3e-59 | |
| 383851242 | 367 | PREDICTED: GTP-binding protein 128up-lik | 0.959 | 0.321 | 0.898 | 5e-59 | |
| 66514467 | 367 | PREDICTED: GTP-binding protein 128up-lik | 0.959 | 0.321 | 0.889 | 7e-59 | |
| 195431080 | 368 | GK21337 [Drosophila willistoni] gi|19415 | 0.959 | 0.320 | 0.898 | 7e-59 | |
| 195123593 | 368 | GI20960 [Drosophila mojavensis] gi|19391 | 0.959 | 0.320 | 0.906 | 1e-58 | |
| 194753347 | 368 | GF12286 [Drosophila ananassae] gi|190620 | 0.959 | 0.320 | 0.898 | 2e-58 | |
| 307190203 | 367 | GTP-binding protein 128up [Camponotus fl | 0.959 | 0.321 | 0.872 | 2e-58 | |
| 350418368 | 367 | PREDICTED: GTP-binding protein 128up-lik | 0.959 | 0.321 | 0.881 | 2e-58 | |
| 311343 | 368 | GTP-binding protein [Drosophila melanoga | 0.959 | 0.320 | 0.898 | 2e-58 |
| >gi|156542821|ref|XP_001607996.1| PREDICTED: GTP-binding protein 128up-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 234 bits (598), Expect = 4e-60, Method: Compositional matrix adjust.
Identities = 106/118 (89%), Positives = 115/118 (97%)
Query: 6 DQISIEELDIIYKIPHCVPLSAHHKWNFDDLLEKMWEYLKLTRIYTKPKGQLPDYQSPVV 65
DQISIEELD+IYKIPHCVP+SAHHKWNFDDLLEKMWEYL+L RIYTKPKGQLPDY SPVV
Sbjct: 250 DQISIEELDVIYKIPHCVPISAHHKWNFDDLLEKMWEYLQLIRIYTKPKGQLPDYNSPVV 309
Query: 66 LHTDRRSIEDFCNKLHRTIAKEFKYALVWGSSVKHQPQKVGKEHVLNDEDVVQIVKKV 123
L+T++RS+EDFCNKLHRTIAKEFKYALVWGSSVKH PQKVGK+H+LNDEDVVQIVKKV
Sbjct: 310 LNTEKRSVEDFCNKLHRTIAKEFKYALVWGSSVKHMPQKVGKDHILNDEDVVQIVKKV 367
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242023708|ref|XP_002432273.1| GTP-binding protein 128up, putative [Pediculus humanus corporis] gi|212517682|gb|EEB19535.1| GTP-binding protein 128up, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|383851242|ref|XP_003701143.1| PREDICTED: GTP-binding protein 128up-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|66514467|ref|XP_394753.2| PREDICTED: GTP-binding protein 128up-like isoform 1 [Apis mellifera] gi|380020421|ref|XP_003694084.1| PREDICTED: GTP-binding protein 128up-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|195431080|ref|XP_002063576.1| GK21337 [Drosophila willistoni] gi|194159661|gb|EDW74562.1| GK21337 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|195123593|ref|XP_002006288.1| GI20960 [Drosophila mojavensis] gi|193911356|gb|EDW10223.1| GI20960 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|194753347|ref|XP_001958975.1| GF12286 [Drosophila ananassae] gi|190620273|gb|EDV35797.1| GF12286 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|307190203|gb|EFN74318.1| GTP-binding protein 128up [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|350418368|ref|XP_003491838.1| PREDICTED: GTP-binding protein 128up-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|311343|emb|CAA50701.1| GTP-binding protein [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 123 | ||||||
| FB|FBgn0010339 | 368 | 128up "upstream of RpIII128" [ | 0.991 | 0.331 | 0.869 | 2e-56 | |
| UNIPROTKB|G3N2L0 | 358 | G3N2L0 "Uncharacterized protei | 0.983 | 0.337 | 0.762 | 8.3e-51 | |
| UNIPROTKB|Q3MHP5 | 367 | DRG1 "Developmentally-regulate | 0.983 | 0.329 | 0.762 | 1.1e-50 | |
| UNIPROTKB|J9JHE3 | 359 | DRG1 "Uncharacterized protein" | 0.983 | 0.337 | 0.762 | 1.1e-50 | |
| UNIPROTKB|J9P0A6 | 367 | DRG1 "Uncharacterized protein" | 0.983 | 0.329 | 0.762 | 1.1e-50 | |
| UNIPROTKB|Q9Y295 | 367 | DRG1 "Developmentally-regulate | 0.983 | 0.329 | 0.762 | 1.1e-50 | |
| UNIPROTKB|F1RPB7 | 358 | DRG1 "Uncharacterized protein" | 0.983 | 0.337 | 0.762 | 1.1e-50 | |
| MGI|MGI:1343297 | 367 | Drg1 "developmentally regulate | 0.983 | 0.329 | 0.762 | 1.1e-50 | |
| RGD|1304993 | 367 | Drg1 "developmentally regulate | 0.983 | 0.329 | 0.762 | 1.1e-50 | |
| ZFIN|ZDB-GENE-030131-8767 | 366 | drg1 "developmentally regulate | 0.983 | 0.330 | 0.745 | 1.7e-50 |
| FB|FBgn0010339 128up "upstream of RpIII128" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 581 (209.6 bits), Expect = 2.0e-56, P = 2.0e-56
Identities = 107/123 (86%), Positives = 114/123 (92%)
Query: 1 MQKVSDQISIEELDIIYKIPHCVPLSAHHKWNFDDLLEKMWEYLKLTRIYTKPKGQLPDY 60
+ K+ DQISIEELD+IYKIPHCVP+SAHH WNFDDLLE MWEYL+L RIYTKPKGQLPDY
Sbjct: 247 LNKI-DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKGQLPDY 305
Query: 61 QSPVVLHTDRRSIEDFCNKLHRTIAKEFKYALVWGSSVKHQPQKVGKEHVLNDEDVVQIV 120
SPVVLH +R SIEDFCNKLHR+IAKEFKYALVWGSSVKHQPQKVG EHVLNDEDVVQIV
Sbjct: 306 NSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKVGIEHVLNDEDVVQIV 365
Query: 121 KKV 123
KKV
Sbjct: 366 KKV 368
|
|
| UNIPROTKB|G3N2L0 G3N2L0 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3MHP5 DRG1 "Developmentally-regulated GTP-binding protein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9JHE3 DRG1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P0A6 DRG1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y295 DRG1 "Developmentally-regulated GTP-binding protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RPB7 DRG1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1343297 Drg1 "developmentally regulated GTP binding protein 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1304993 Drg1 "developmentally regulated GTP binding protein 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-8767 drg1 "developmentally regulated GTP binding protein 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 123 | |||
| COG1163 | 365 | COG1163, DRG, Predicted GTPase [General function p | 4e-52 | |
| cd01666 | 75 | cd01666, TGS_DRG_C, TGS_DRG_C: DRG (developmentall | 2e-42 | |
| cd01896 | 233 | cd01896, DRG, Developmentally Regulated GTP-bindin | 1e-21 | |
| pfam02824 | 60 | pfam02824, TGS, TGS domain | 4e-17 | |
| cd01616 | 60 | cd01616, TGS, The TGS domain, named after the ThrR | 4e-09 | |
| cd04938 | 76 | cd04938, TGS_Obg-like, TGS_Obg-like: The C-termina | 2e-08 |
| >gnl|CDD|224085 COG1163, DRG, Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
Score = 167 bits (425), Expect = 4e-52
Identities = 53/117 (45%), Positives = 78/117 (66%), Gaps = 1/117 (0%)
Query: 6 DQISIEELDIIYKIPHCVPLSAHHKWNFDDLLEKMWEYLKLTRIYTKPKGQLPDYQSPVV 65
D +EEL+ + + P+ VP+SA N D+L E++W+ L L R+YTKP G+ PD+ P++
Sbjct: 250 DLPGLEELERLARKPNSVPISAKKGINLDELKERIWDVLGLIRVYTKPPGEEPDFDEPLI 309
Query: 66 LHTDRRSIEDFCNKLHRTIAKEFKYALVWGSSVKHQPQKVGKEHVLNDEDVVQIVKK 122
L ++ D C K+HR + + F+YA VWG SVKH Q+VG +HVL DED+V+I K
Sbjct: 310 LRRGS-TVGDVCRKIHRDLVENFRYARVWGKSVKHPGQRVGLDHVLEDEDIVEIHAK 365
|
Length = 365 |
| >gnl|CDD|133436 cd01666, TGS_DRG_C, TGS_DRG_C: DRG (developmentally regulated GTP-binding protein) represents a family of GTP-binding proteins that includes two members, DRG1 and DRG2 | Back alignment and domain information |
|---|
| >gnl|CDD|206683 cd01896, DRG, Developmentally Regulated GTP-binding protein (DRG) | Back alignment and domain information |
|---|
| >gnl|CDD|217243 pfam02824, TGS, TGS domain | Back alignment and domain information |
|---|
| >gnl|CDD|133435 cd01616, TGS, The TGS domain, named after the ThrRS, GTPase, and SpoT/RelA proteins where it occurs, is structurally similar to ubiquitin | Back alignment and domain information |
|---|
| >gnl|CDD|133441 cd04938, TGS_Obg-like, TGS_Obg-like: The C-terminal TGS domain of Obg-like GTPases such as those present in DRG (developmentally regulated GTP-binding protein), and GTP-binding proteins Ygr210 and YchF | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 123 | |||
| COG1163 | 365 | DRG Predicted GTPase [General function prediction | 100.0 | |
| KOG1486|consensus | 364 | 100.0 | ||
| KOG1487|consensus | 358 | 100.0 | ||
| cd01666 | 75 | TGS_DRG_C TGS_DRG_C: DRG (developmentally regulate | 100.0 | |
| cd04938 | 76 | TGS_Obg-like TGS_Obg-like: The C-terminal TGS doma | 99.94 | |
| PRK09602 | 396 | translation-associated GTPase; Reviewed | 99.93 | |
| PTZ00258 | 390 | GTP-binding protein; Provisional | 99.92 | |
| cd01669 | 76 | TGS_Ygr210_C TGS_Ygr210_C: The C-terminal TGS doma | 99.81 | |
| PRK09601 | 364 | GTP-binding protein YchF; Reviewed | 99.79 | |
| PF02824 | 60 | TGS: TGS domain; InterPro: IPR004095 The TGS domai | 99.65 | |
| PF06071 | 84 | YchF-GTPase_C: Protein of unknown function (DUF933 | 99.64 | |
| cd04867 | 83 | TGS_YchF_C TGS_YchF_C: This subfamily represents T | 99.56 | |
| TIGR00092 | 368 | GTP-binding protein YchF. This predicted GTP-bindi | 99.54 | |
| COG0012 | 372 | Predicted GTPase, probable translation factor [Tra | 99.39 | |
| KOG1491|consensus | 391 | 99.21 | ||
| PRK10872 | 743 | relA (p)ppGpp synthetase I/GTP pyrophosphokinase; | 99.17 | |
| TIGR00691 | 683 | spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( | 99.1 | |
| cd01896 | 233 | DRG The developmentally regulated GTP-binding prot | 99.05 | |
| PRK11092 | 702 | bifunctional (p)ppGpp synthetase II/ guanosine-3', | 98.71 | |
| COG0317 | 701 | SpoT Guanosine polyphosphate pyrophosphohydrolases | 98.56 | |
| cd01616 | 60 | TGS The TGS domain, named after the ThrRS, GTPase, | 98.11 | |
| COG2262 | 411 | HflX GTPases [General function prediction only] | 97.9 | |
| TIGR03156 | 351 | GTP_HflX GTP-binding protein HflX. This protein fa | 97.52 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 97.52 | |
| PF08438 | 109 | MMR_HSR1_C: GTPase of unknown function C-terminal; | 97.49 | |
| cd01668 | 60 | TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) prote | 97.48 | |
| PF00009 | 188 | GTP_EFTU: Elongation factor Tu GTP binding domain; | 97.45 | |
| cd01859 | 156 | MJ1464 MJ1464. This family represents archaeal GTP | 97.39 | |
| COG1159 | 298 | Era GTPase [General function prediction only] | 97.36 | |
| cd01897 | 168 | NOG NOG1 is a nucleolar GTP-binding protein presen | 97.35 | |
| cd01856 | 171 | YlqF YlqF. Proteins of the YlqF family contain all | 97.31 | |
| cd01888 | 203 | eIF2_gamma eIF2-gamma (gamma subunit of initiation | 97.3 | |
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 97.28 | |
| PRK04213 | 201 | GTP-binding protein; Provisional | 97.23 | |
| cd01849 | 155 | YlqF_related_GTPase YlqF-related GTPases. These pr | 97.22 | |
| COG0481 | 603 | LepA Membrane GTPase LepA [Cell envelope biogenesi | 97.2 | |
| cd01894 | 157 | EngA1 EngA1 subfamily. This CD represents the firs | 97.19 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 97.18 | |
| KOG1489|consensus | 366 | 97.17 | ||
| PRK01777 | 95 | hypothetical protein; Validated | 97.15 | |
| TIGR00101 | 199 | ureG urease accessory protein UreG. This model rep | 97.13 | |
| cd04164 | 157 | trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein | 97.09 | |
| TIGR02729 | 329 | Obg_CgtA Obg family GTPase CgtA. This model descri | 97.09 | |
| cd01890 | 179 | LepA LepA subfamily. LepA belongs to the GTPase fa | 97.08 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 97.08 | |
| PTZ00327 | 460 | eukaryotic translation initiation factor 2 gamma s | 97.07 | |
| PRK15467 | 158 | ethanolamine utilization protein EutP; Provisional | 97.05 | |
| cd01881 | 176 | Obg_like The Obg-like subfamily consists of five w | 97.04 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 97.04 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 97.0 | |
| cd01899 | 318 | Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg | 97.0 | |
| cd01898 | 170 | Obg Obg subfamily. The Obg nucleotide binding prot | 96.95 | |
| PRK09866 | 741 | hypothetical protein; Provisional | 96.95 | |
| PRK12297 | 424 | obgE GTPase CgtA; Reviewed | 96.95 | |
| cd04152 | 183 | Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i | 96.94 | |
| KOG0462|consensus | 650 | 96.93 | ||
| KOG1487|consensus | 358 | 96.91 | ||
| PRK15494 | 339 | era GTPase Era; Provisional | 96.89 | |
| PRK12299 | 335 | obgE GTPase CgtA; Reviewed | 96.86 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 96.86 | |
| cd01889 | 192 | SelB_euk SelB subfamily. SelB is an elongation fac | 96.85 | |
| cd01864 | 165 | Rab19 Rab19 subfamily. Rab19 proteins are associat | 96.83 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 96.83 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 96.83 | |
| PRK12298 | 390 | obgE GTPase CgtA; Reviewed | 96.8 | |
| PRK12296 | 500 | obgE GTPase CgtA; Reviewed | 96.8 | |
| cd04175 | 164 | Rap1 Rap1 subgroup. The Rap1 subgroup is part of t | 96.79 | |
| COG5257 | 415 | GCD11 Translation initiation factor 2, gamma subun | 96.79 | |
| cd04171 | 164 | SelB SelB subfamily. SelB is an elongation factor | 96.77 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 96.76 | |
| cd01862 | 172 | Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th | 96.73 | |
| cd00881 | 189 | GTP_translation_factor GTP translation factor fami | 96.72 | |
| cd01892 | 169 | Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr | 96.71 | |
| PRK10512 | 614 | selenocysteinyl-tRNA-specific translation factor; | 96.7 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 96.7 | |
| TIGR02528 | 142 | EutP ethanolamine utilization protein, EutP. This | 96.7 | |
| PRK11058 | 426 | GTPase HflX; Provisional | 96.7 | |
| cd04151 | 158 | Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t | 96.7 | |
| COG0536 | 369 | Obg Predicted GTPase [General function prediction | 96.69 | |
| cd01879 | 158 | FeoB Ferrous iron transport protein B (FeoB) subfa | 96.67 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 96.67 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 96.66 | |
| cd01863 | 161 | Rab18 Rab18 subfamily. Mammalian Rab18 is implicat | 96.66 | |
| cd04157 | 162 | Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub | 96.63 | |
| cd04119 | 168 | RJL RJL (RabJ-Like) subfamily. RJLs are found in m | 96.61 | |
| PRK05291 | 449 | trmE tRNA modification GTPase TrmE; Reviewed | 96.6 | |
| smart00177 | 175 | ARF ARF-like small GTPases; ARF, ADP-ribosylation | 96.57 | |
| cd04107 | 201 | Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 | 96.55 | |
| PRK12289 | 352 | GTPase RsgA; Reviewed | 96.54 | |
| cd04165 | 224 | GTPBP1_like GTPBP1-like. Mammalian GTP binding pro | 96.54 | |
| cd01860 | 163 | Rab5_related Rab5-related subfamily. This subfamil | 96.51 | |
| TIGR03596 | 276 | GTPase_YlqF ribosome biogenesis GTP-binding protei | 96.49 | |
| smart00173 | 164 | RAS Ras subfamily of RAS small GTPases. Similar in | 96.49 | |
| cd04136 | 163 | Rap_like Rap-like subfamily. The Rap subfamily con | 96.48 | |
| cd01865 | 165 | Rab3 Rab3 subfamily. The Rab3 subfamily contains R | 96.48 | |
| cd04127 | 180 | Rab27A Rab27a subfamily. The Rab27a subfamily cons | 96.48 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 96.46 | |
| PRK00454 | 196 | engB GTP-binding protein YsxC; Reviewed | 96.46 | |
| PF03658 | 84 | Ub-RnfH: RnfH family Ubiquitin; InterPro: IPR00534 | 96.45 | |
| cd04112 | 191 | Rab26 Rab26 subfamily. First identified in rat pan | 96.44 | |
| PLN00223 | 181 | ADP-ribosylation factor; Provisional | 96.42 | |
| PTZ00099 | 176 | rab6; Provisional | 96.41 | |
| cd04160 | 167 | Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote | 96.41 | |
| cd04154 | 173 | Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are | 96.4 | |
| cd00880 | 163 | Era_like Era (E. coli Ras-like protein)-like. This | 96.4 | |
| cd04145 | 164 | M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf | 96.4 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 96.38 | |
| cd04123 | 162 | Rab21 Rab21 subfamily. The localization and functi | 96.38 | |
| cd04109 | 215 | Rab28 Rab28 subfamily. First identified in maize, | 96.38 | |
| cd04144 | 190 | Ras2 Ras2 subfamily. The Ras2 subfamily, found exc | 96.37 | |
| cd01895 | 174 | EngA2 EngA2 subfamily. This CD represents the seco | 96.37 | |
| COG0486 | 454 | ThdF Predicted GTPase [General function prediction | 96.36 | |
| cd01869 | 166 | Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev | 96.35 | |
| cd04129 | 187 | Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that | 96.35 | |
| PRK04000 | 411 | translation initiation factor IF-2 subunit gamma; | 96.35 | |
| cd04106 | 162 | Rab23_lke Rab23-like subfamily. Rab23 is a member | 96.35 | |
| cd04156 | 160 | ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su | 96.33 | |
| cd01861 | 161 | Rab6 Rab6 subfamily. Rab6 is involved in microtubu | 96.32 | |
| TIGR03680 | 406 | eif2g_arch translation initiation factor 2 subunit | 96.31 | |
| cd01876 | 170 | YihA_EngB The YihA (EngB) subfamily. This subfamil | 96.28 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 96.27 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 96.27 | |
| smart00174 | 174 | RHO Rho (Ras homology) subfamily of Ras-like small | 96.25 | |
| cd04158 | 169 | ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor | 96.24 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 96.17 | |
| PLN03118 | 211 | Rab family protein; Provisional | 96.17 | |
| PRK13768 | 253 | GTPase; Provisional | 96.16 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 96.16 | |
| cd04149 | 168 | Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor | 96.15 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 96.14 | |
| cd04140 | 165 | ARHI_like ARHI subfamily. ARHI (A Ras homolog memb | 96.12 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 96.11 | |
| TIGR00475 | 581 | selB selenocysteine-specific elongation factor Sel | 96.1 | |
| KOG1145|consensus | 683 | 96.1 | ||
| cd01871 | 174 | Rac1_like Rac1-like subfamily. The Rac1-like subfa | 96.1 | |
| cd04176 | 163 | Rap2 Rap2 subgroup. The Rap2 subgroup is part of t | 96.1 | |
| cd01867 | 167 | Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp | 96.1 | |
| cd04124 | 161 | RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily | 96.09 | |
| cd00879 | 190 | Sar1 Sar1 subfamily. Sar1 is an essential componen | 96.08 | |
| cd04128 | 182 | Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi | 96.06 | |
| cd04143 | 247 | Rhes_like Rhes_like subfamily. This subfamily incl | 96.06 | |
| cd04150 | 159 | Arf1_5_like Arf1-Arf5-like subfamily. This subfami | 96.06 | |
| cd04137 | 180 | RheB Rheb (Ras Homolog Enriched in Brain) subfamil | 96.06 | |
| PRK05433 | 600 | GTP-binding protein LepA; Provisional | 96.05 | |
| PRK09563 | 287 | rbgA GTPase YlqF; Reviewed | 96.04 | |
| PRK12288 | 347 | GTPase RsgA; Reviewed | 96.03 | |
| cd01893 | 166 | Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr | 95.99 | |
| cd04116 | 170 | Rab9 Rab9 subfamily. Rab9 is found in late endosom | 95.98 | |
| cd04114 | 169 | Rab30 Rab30 subfamily. Rab30 appears to be associa | 95.97 | |
| cd01887 | 168 | IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo | 95.95 | |
| cd01868 | 165 | Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a | 95.95 | |
| TIGR01393 | 595 | lepA GTP-binding protein LepA. LepA (GUF1 in Sacca | 95.94 | |
| cd04118 | 193 | Rab24 Rab24 subfamily. Rab24 is distinct from othe | 95.93 | |
| cd04126 | 220 | Rab20 Rab20 subfamily. Rab20 is one of several Rab | 95.91 | |
| cd04101 | 164 | RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove | 95.89 | |
| cd04141 | 172 | Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p | 95.89 | |
| cd04153 | 174 | Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a | 95.88 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 95.85 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 95.84 | |
| PRK13796 | 365 | GTPase YqeH; Provisional | 95.83 | |
| cd04122 | 166 | Rab14 Rab14 subfamily. Rab14 GTPases are localized | 95.82 | |
| smart00178 | 184 | SAR Sar1p-like members of the Ras-family of small | 95.82 | |
| cd04148 | 221 | RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki | 95.81 | |
| cd00876 | 160 | Ras Ras family. The Ras family of the Ras superfam | 95.8 | |
| cd04142 | 198 | RRP22 RRP22 subfamily. RRP22 (Ras-related protein | 95.78 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 95.78 | |
| PTZ00133 | 182 | ADP-ribosylation factor; Provisional | 95.76 | |
| PRK01889 | 356 | GTPase RsgA; Reviewed | 95.74 | |
| cd04147 | 198 | Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v | 95.74 | |
| cd00878 | 158 | Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik | 95.72 | |
| cd00877 | 166 | Ran Ran (Ras-related nuclear proteins) /TC4 subfam | 95.69 | |
| cd04132 | 187 | Rho4_like Rho4-like subfamily. Rho4 is a GTPase th | 95.69 | |
| TIGR03597 | 360 | GTPase_YqeH ribosome biogenesis GTPase YqeH. This | 95.63 | |
| cd04110 | 199 | Rab35 Rab35 subfamily. Rab35 is one of several Rab | 95.62 | |
| cd04135 | 174 | Tc10 TC10 subfamily. TC10 is a Rho family protein | 95.59 | |
| TIGR00157 | 245 | ribosome small subunit-dependent GTPase A. The Aqu | 95.59 | |
| smart00175 | 164 | RAB Rab subfamily of small GTPases. Rab GTPases ar | 95.58 | |
| cd04133 | 176 | Rop_like Rop subfamily. The Rop (Rho-related prote | 95.57 | |
| cd04125 | 188 | RabA_like RabA-like subfamily. RabA was first iden | 95.48 | |
| cd04108 | 170 | Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr | 95.47 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 95.46 | |
| cd01866 | 168 | Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg | 95.46 | |
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 95.45 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 95.42 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 95.37 | |
| cd04120 | 202 | Rab12 Rab12 subfamily. Rab12 was first identified | 95.35 | |
| COG0532 | 509 | InfB Translation initiation factor 2 (IF-2; GTPase | 95.32 | |
| cd04111 | 211 | Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 | 95.32 | |
| cd04130 | 173 | Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive | 95.28 | |
| PLN03110 | 216 | Rab GTPase; Provisional | 95.27 | |
| cd00157 | 171 | Rho Rho (Ras homology) family. Members of the Rho | 95.27 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 95.25 | |
| cd01870 | 175 | RhoA_like RhoA-like subfamily. The RhoA subfamily | 95.25 | |
| cd01875 | 191 | RhoG RhoG subfamily. RhoG is a GTPase with high se | 95.25 | |
| TIGR00437 | 591 | feoB ferrous iron transporter FeoB. FeoB (773 amin | 95.23 | |
| cd04113 | 161 | Rab4 Rab4 subfamily. Rab4 has been implicated in n | 95.17 | |
| cd04117 | 161 | Rab15 Rab15 subfamily. Rab15 colocalizes with the | 95.17 | |
| cd04121 | 189 | Rab40 Rab40 subfamily. This subfamily contains Rab | 95.01 | |
| PTZ00369 | 189 | Ras-like protein; Provisional | 94.93 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 94.89 | |
| cd01883 | 219 | EF1_alpha Eukaryotic elongation factor 1 (EF1) alp | 94.86 | |
| cd04134 | 189 | Rho3 Rho3 subfamily. Rho3 is a member of the Rho f | 94.78 | |
| cd01874 | 175 | Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas | 94.78 | |
| cd04146 | 165 | RERG_RasL11_like RERG/RasL11-like subfamily. RERG | 94.76 | |
| cd01667 | 61 | TGS_ThrRS_N TGS _ThrRS_N: ThrRS (threonyl-tRNA Syn | 94.75 | |
| KOG0092|consensus | 200 | 94.74 | ||
| cd04103 | 158 | Centaurin_gamma Centaurin gamma. The centaurins (a | 94.72 | |
| cd04177 | 168 | RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the | 94.71 | |
| PRK06944 | 65 | sulfur carrier protein ThiS; Provisional | 94.63 | |
| cd01873 | 195 | RhoBTB RhoBTB subfamily. Members of the RhoBTB sub | 94.54 | |
| PRK05124 | 474 | cysN sulfate adenylyltransferase subunit 1; Provis | 94.53 | |
| PRK05659 | 66 | sulfur carrier protein ThiS; Validated | 94.53 | |
| PRK09554 | 772 | feoB ferrous iron transport protein B; Reviewed | 94.48 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 94.4 | |
| cd00882 | 157 | Ras_like_GTPase Ras-like GTPase superfamily. The R | 94.4 | |
| PLN02799 | 82 | Molybdopterin synthase sulfur carrier subunit | 94.37 | |
| cd01884 | 195 | EF_Tu EF-Tu subfamily. This subfamily includes ort | 94.36 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 94.17 | |
| TIGR01683 | 64 | thiS thiamine biosynthesis protein ThiS. This mode | 94.1 | |
| PRK12317 | 425 | elongation factor 1-alpha; Reviewed | 94.09 | |
| cd04174 | 232 | Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb | 94.05 | |
| COG1162 | 301 | Predicted GTPases [General function prediction onl | 94.02 | |
| cd01891 | 194 | TypA_BipA TypA (tyrosine phosphorylated protein A) | 94.0 | |
| cd04166 | 208 | CysN_ATPS CysN_ATPS subfamily. CysN, together with | 93.93 | |
| COG3276 | 447 | SelB Selenocysteine-specific translation elongatio | 93.92 | |
| PF02597 | 77 | ThiS: ThiS family; InterPro: IPR003749 ThiS (thiam | 93.92 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 93.85 | |
| PLN03108 | 210 | Rab family protein; Provisional | 93.82 | |
| COG0218 | 200 | Predicted GTPase [General function prediction only | 93.71 | |
| cd04172 | 182 | Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE | 93.69 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 93.68 | |
| PRK14845 | 1049 | translation initiation factor IF-2; Provisional | 93.67 | |
| cd00754 | 80 | MoaD Ubiquitin domain of MoaD-like proteins. MoaD | 93.56 | |
| PRK06437 | 67 | hypothetical protein; Provisional | 93.52 | |
| TIGR00483 | 426 | EF-1_alpha translation elongation factor EF-1 alph | 93.31 | |
| smart00176 | 200 | RAN Ran (Ras-related nuclear proteins) /TC4 subfam | 93.23 | |
| TIGR00491 | 590 | aIF-2 translation initiation factor aIF-2/yIF-2. T | 93.23 | |
| cd04131 | 178 | Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 | 93.19 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 93.19 | |
| PLN03071 | 219 | GTP-binding nuclear protein Ran; Provisional | 93.14 | |
| COG0370 | 653 | FeoB Fe2+ transport system protein B [Inorganic io | 93.11 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 92.94 | |
| COG0050 | 394 | TufB GTPases - translation elongation factors [Tra | 92.93 | |
| PRK04004 | 586 | translation initiation factor IF-2; Validated | 92.92 | |
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 92.69 | |
| TIGR02034 | 406 | CysN sulfate adenylyltransferase, large subunit. H | 92.65 | |
| KOG0466|consensus | 466 | 92.18 | ||
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 92.03 | |
| cd04104 | 197 | p47_IIGP_like p47 (47-kDa) family. The p47 GTPase | 92.01 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 92.01 | |
| cd00565 | 65 | ThiS ThiaminS ubiquitin-like sulfur carrier protei | 91.98 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 91.94 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 91.8 | |
| COG5256 | 428 | TEF1 Translation elongation factor EF-1alpha (GTPa | 91.74 | |
| COG2895 | 431 | CysN GTPases - Sulfate adenylate transferase subun | 91.6 | |
| COG4917 | 148 | EutP Ethanolamine utilization protein [Amino acid | 91.1 | |
| KOG0094|consensus | 221 | 91.03 | ||
| PRK00049 | 396 | elongation factor Tu; Reviewed | 90.97 | |
| COG2914 | 99 | Uncharacterized protein conserved in bacteria [Fun | 90.78 | |
| CHL00071 | 409 | tufA elongation factor Tu | 90.4 | |
| cd01764 | 94 | Urm1 Urm1-like ubuitin domain. Urm1 (Ubiquitin-Rel | 90.35 | |
| TIGR01682 | 80 | moaD molybdopterin converting factor, subunit 1, n | 90.31 | |
| cd04115 | 170 | Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u | 90.17 | |
| KOG0410|consensus | 410 | 89.5 | ||
| TIGR01394 | 594 | TypA_BipA GTP-binding protein TypA/BipA. This bact | 89.5 | |
| PLN00043 | 447 | elongation factor 1-alpha; Provisional | 89.49 | |
| PRK08053 | 66 | sulfur carrier protein ThiS; Provisional | 89.37 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 89.27 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 88.91 | |
| PRK08364 | 70 | sulfur carrier protein ThiS; Provisional | 88.64 | |
| KOG0461|consensus | 522 | 88.56 | ||
| KOG1423|consensus | 379 | 88.48 | ||
| PRK10218 | 607 | GTP-binding protein; Provisional | 88.3 | |
| PTZ00132 | 215 | GTP-binding nuclear protein Ran; Provisional | 87.88 | |
| KOG0088|consensus | 218 | 87.34 | ||
| COG1084 | 346 | Predicted GTPase [General function prediction only | 87.26 | |
| PF00025 | 175 | Arf: ADP-ribosylation factor family The prints ent | 86.94 | |
| PRK07440 | 70 | hypothetical protein; Provisional | 86.89 | |
| PRK11130 | 81 | moaD molybdopterin synthase small subunit; Provisi | 86.74 | |
| PF09138 | 96 | Urm1: Urm1 (Ubiquitin related modifier); InterPro: | 86.64 | |
| PTZ00141 | 446 | elongation factor 1- alpha; Provisional | 86.55 | |
| cd04162 | 164 | Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 | 85.9 | |
| PF00071 | 162 | Ras: Ras family; InterPro: IPR001806 Small GTPases | 85.89 | |
| cd04173 | 222 | Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb | 85.79 | |
| COG2104 | 68 | ThiS Sulfur transfer protein involved in thiamine | 85.77 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 85.62 | |
| KOG1191|consensus | 531 | 85.26 | ||
| PRK06488 | 65 | sulfur carrier protein ThiS; Validated | 85.14 | |
| PRK00413 | 638 | thrS threonyl-tRNA synthetase; Reviewed | 85.01 | |
| KOG0083|consensus | 192 | 84.34 | ||
| PRK07696 | 67 | sulfur carrier protein ThiS; Provisional | 84.22 | |
| cd04161 | 167 | Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( | 83.12 | |
| COG1977 | 84 | MoaD Molybdopterin converting factor, small subuni | 83.09 | |
| COG1161 | 322 | Predicted GTPases [General function prediction onl | 83.04 | |
| KOG0460|consensus | 449 | 82.91 | ||
| PF14451 | 81 | Ub-Mut7C: Mut7-C ubiquitin | 82.37 | |
| KOG0078|consensus | 207 | 82.11 | ||
| cd04167 | 213 | Snu114p Snu114p subfamily. Snu114p is one of sever | 80.63 |
| >COG1163 DRG Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.3e-47 Score=304.17 Aligned_cols=121 Identities=44% Similarity=0.848 Sum_probs=117.6
Q ss_pred CcccCCCCCHhhHHHHhcCCCeEEEeecCCcChHHHHHHHHHhhccceEEeCCCCCCCCCcccEEEeCCCCCHHHHHHHh
Q psy2927 1 MQKVSDQISIEELDIIYKIPHCVPLSAHHKWNFDDLLEKMWEYLKLTRIYTKPKGQLPDYQSPVVLHTDRRSIEDFCNKL 80 (123)
Q Consensus 1 V~NKiD~~~~e~l~~l~~~~~~v~ISA~~~~gld~L~e~i~~~L~~irvytk~~g~~pd~~~~~~l~~g~~tv~d~a~~I 80 (123)
|+||+|+++.++++.+.+.+++++|||.+++|+++|++.||+.|+++|||||++|..||+++|++|++| |||+|+|++|
T Consensus 245 v~NKiD~~~~e~~~~l~~~~~~v~isa~~~~nld~L~e~i~~~L~liRVYtK~~g~~pd~~~PlIlr~G-sTV~Dvc~~I 323 (365)
T COG1163 245 VVNKIDLPGLEELERLARKPNSVPISAKKGINLDELKERIWDVLGLIRVYTKPPGEEPDFDEPLILRRG-STVGDVCRKI 323 (365)
T ss_pred EEecccccCHHHHHHHHhccceEEEecccCCCHHHHHHHHHHhhCeEEEEecCCCCCCCCCCCeEEeCC-CcHHHHHHHH
Confidence 689999999999999977789999999999999999999999999999999999999999999999998 9999999999
Q ss_pred HHHHHhhcceeEEecCCCCCCCceeCCCceecCCCeEEEEec
Q psy2927 81 HRTIAKEFKYALVWGSSVKHQPQKVGKEHVLNDEDVVQIVKK 122 (123)
Q Consensus 81 H~d~~~~f~~A~vwg~s~k~~~q~vg~~~~l~d~Dvv~i~~~ 122 (123)
|+||.++|+||+|||+|+||+|||||+||+|+|||||+|+.+
T Consensus 324 H~~l~~~FryA~VWGkSvk~~~QrVG~dHvLeD~DIV~I~~k 365 (365)
T COG1163 324 HRDLVENFRYARVWGKSVKHPGQRVGLDHVLEDEDIVEIHAK 365 (365)
T ss_pred HHHHHHhcceEEEeccCCCCCccccCcCcCccCCCeEEEeeC
Confidence 999999999999999999999999999999999999999975
|
|
| >KOG1486|consensus | Back alignment and domain information |
|---|
| >KOG1487|consensus | Back alignment and domain information |
|---|
| >cd01666 TGS_DRG_C TGS_DRG_C: DRG (developmentally regulated GTP-binding protein) represents a family of GTP-binding proteins that includes two members, DRG1 and DRG2 | Back alignment and domain information |
|---|
| >cd04938 TGS_Obg-like TGS_Obg-like: The C-terminal TGS domain of Obg-like GTPases such as those present in DRG (developmentally regulated GTP-binding protein), and GTP-binding proteins Ygr210 and YchF | Back alignment and domain information |
|---|
| >PRK09602 translation-associated GTPase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00258 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd01669 TGS_Ygr210_C TGS_Ygr210_C: The C-terminal TGS domain of Ygr210 GTP-binding protein which is a member of Obg-like family of GTPases, and present in archaea | Back alignment and domain information |
|---|
| >PRK09601 GTP-binding protein YchF; Reviewed | Back alignment and domain information |
|---|
| >PF02824 TGS: TGS domain; InterPro: IPR004095 The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) [] | Back alignment and domain information |
|---|
| >PF06071 YchF-GTPase_C: Protein of unknown function (DUF933); InterPro: IPR013029 This domain is found at the C terminus of family of conserved hypothetical proteins found in both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >cd04867 TGS_YchF_C TGS_YchF_C: This subfamily represents TGS domain-containing YchF GTP-binding protein, a universally conserved GTPase whose function is unknown | Back alignment and domain information |
|---|
| >TIGR00092 GTP-binding protein YchF | Back alignment and domain information |
|---|
| >COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1491|consensus | Back alignment and domain information |
|---|
| >PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family | Back alignment and domain information |
|---|
| >cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins | Back alignment and domain information |
|---|
| >PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >cd01616 TGS The TGS domain, named after the ThrRS, GTPase, and SpoT/RelA proteins where it occurs, is structurally similar to ubiquitin | Back alignment and domain information |
|---|
| >COG2262 HflX GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03156 GTP_HflX GTP-binding protein HflX | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >PF08438 MMR_HSR1_C: GTPase of unknown function C-terminal; InterPro: IPR013646 This domain is found at the C terminus of IPR002917 from INTERPRO in archaeal and eukaryotic GTP-binding proteins | Back alignment and domain information |
|---|
| >cd01668 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) protein, also referred to as ppGpp hydrolase/synthetase, is a ribosome-associated protein that is activated during amino acid starvation and thought to mediate the stringent response | Back alignment and domain information |
|---|
| >PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site | Back alignment and domain information |
|---|
| >cd01859 MJ1464 MJ1464 | Back alignment and domain information |
|---|
| >COG1159 Era GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans | Back alignment and domain information |
|---|
| >cd01856 YlqF YlqF | Back alignment and domain information |
|---|
| >cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >PRK04213 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd01849 YlqF_related_GTPase YlqF-related GTPases | Back alignment and domain information |
|---|
| >COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd01894 EngA1 EngA1 subfamily | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >KOG1489|consensus | Back alignment and domain information |
|---|
| >PRK01777 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR00101 ureG urease accessory protein UreG | Back alignment and domain information |
|---|
| >cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >TIGR02729 Obg_CgtA Obg family GTPase CgtA | Back alignment and domain information |
|---|
| >cd01890 LepA LepA subfamily | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15467 ethanolamine utilization protein EutP; Provisional | Back alignment and domain information |
|---|
| >cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >cd01899 Ygr210 Ygr210 subfamily | Back alignment and domain information |
|---|
| >cd01898 Obg Obg subfamily | Back alignment and domain information |
|---|
| >PRK09866 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12297 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd04152 Arl4_Arl7 Arl4/Arl7 subfamily | Back alignment and domain information |
|---|
| >KOG0462|consensus | Back alignment and domain information |
|---|
| >KOG1487|consensus | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >PRK12299 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >cd01889 SelB_euk SelB subfamily | Back alignment and domain information |
|---|
| >cd01864 Rab19 Rab19 subfamily | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >PRK12298 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >PRK12296 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd04175 Rap1 Rap1 subgroup | Back alignment and domain information |
|---|
| >COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04171 SelB SelB subfamily | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd01862 Rab7 Rab7 subfamily | Back alignment and domain information |
|---|
| >cd00881 GTP_translation_factor GTP translation factor family | Back alignment and domain information |
|---|
| >cd01892 Miro2 Miro2 subfamily | Back alignment and domain information |
|---|
| >PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >TIGR02528 EutP ethanolamine utilization protein, EutP | Back alignment and domain information |
|---|
| >PRK11058 GTPase HflX; Provisional | Back alignment and domain information |
|---|
| >cd04151 Arl1 Arl1 subfamily | Back alignment and domain information |
|---|
| >COG0536 Obg Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >cd01863 Rab18 Rab18 subfamily | Back alignment and domain information |
|---|
| >cd04157 Arl6 Arl6 subfamily | Back alignment and domain information |
|---|
| >cd04119 RJL RJL (RabJ-Like) subfamily | Back alignment and domain information |
|---|
| >PRK05291 trmE tRNA modification GTPase TrmE; Reviewed | Back alignment and domain information |
|---|
| >smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor | Back alignment and domain information |
|---|
| >cd04107 Rab32_Rab38 Rab38/Rab32 subfamily | Back alignment and domain information |
|---|
| >PRK12289 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd04165 GTPBP1_like GTPBP1-like | Back alignment and domain information |
|---|
| >cd01860 Rab5_related Rab5-related subfamily | Back alignment and domain information |
|---|
| >TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >smart00173 RAS Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >cd04136 Rap_like Rap-like subfamily | Back alignment and domain information |
|---|
| >cd01865 Rab3 Rab3 subfamily | Back alignment and domain information |
|---|
| >cd04127 Rab27A Rab27a subfamily | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >PRK00454 engB GTP-binding protein YsxC; Reviewed | Back alignment and domain information |
|---|
| >PF03658 Ub-RnfH: RnfH family Ubiquitin; InterPro: IPR005346 This is a small family of proteins of unknown function | Back alignment and domain information |
|---|
| >cd04112 Rab26 Rab26 subfamily | Back alignment and domain information |
|---|
| >PLN00223 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >PTZ00099 rab6; Provisional | Back alignment and domain information |
|---|
| >cd04160 Arfrp1 Arfrp1 subfamily | Back alignment and domain information |
|---|
| >cd04154 Arl2 Arl2 subfamily | Back alignment and domain information |
|---|
| >cd00880 Era_like Era (E | Back alignment and domain information |
|---|
| >cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >cd04123 Rab21 Rab21 subfamily | Back alignment and domain information |
|---|
| >cd04109 Rab28 Rab28 subfamily | Back alignment and domain information |
|---|
| >cd04144 Ras2 Ras2 subfamily | Back alignment and domain information |
|---|
| >cd01895 EngA2 EngA2 subfamily | Back alignment and domain information |
|---|
| >COG0486 ThdF Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily | Back alignment and domain information |
|---|
| >cd04129 Rho2 Rho2 subfamily | Back alignment and domain information |
|---|
| >PRK04000 translation initiation factor IF-2 subunit gamma; Validated | Back alignment and domain information |
|---|
| >cd04106 Rab23_lke Rab23-like subfamily | Back alignment and domain information |
|---|
| >cd04156 ARLTS1 ARLTS1 subfamily | Back alignment and domain information |
|---|
| >cd01861 Rab6 Rab6 subfamily | Back alignment and domain information |
|---|
| >TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma | Back alignment and domain information |
|---|
| >cd01876 YihA_EngB The YihA (EngB) subfamily | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases | Back alignment and domain information |
|---|
| >cd04158 ARD1 ARD1 subfamily | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >PLN03118 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >cd04149 Arf6 Arf6 subfamily | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >cd04140 ARHI_like ARHI subfamily | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >TIGR00475 selB selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >KOG1145|consensus | Back alignment and domain information |
|---|
| >cd01871 Rac1_like Rac1-like subfamily | Back alignment and domain information |
|---|
| >cd04176 Rap2 Rap2 subgroup | Back alignment and domain information |
|---|
| >cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 | Back alignment and domain information |
|---|
| >cd04124 RabL2 RabL2 subfamily | Back alignment and domain information |
|---|
| >cd00879 Sar1 Sar1 subfamily | Back alignment and domain information |
|---|
| >cd04128 Spg1 Spg1p | Back alignment and domain information |
|---|
| >cd04143 Rhes_like Rhes_like subfamily | Back alignment and domain information |
|---|
| >cd04150 Arf1_5_like Arf1-Arf5-like subfamily | Back alignment and domain information |
|---|
| >cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily | Back alignment and domain information |
|---|
| >PRK05433 GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >PRK09563 rbgA GTPase YlqF; Reviewed | Back alignment and domain information |
|---|
| >PRK12288 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd01893 Miro1 Miro1 subfamily | Back alignment and domain information |
|---|
| >cd04116 Rab9 Rab9 subfamily | Back alignment and domain information |
|---|
| >cd04114 Rab30 Rab30 subfamily | Back alignment and domain information |
|---|
| >cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily | Back alignment and domain information |
|---|
| >cd01868 Rab11_like Rab11-like | Back alignment and domain information |
|---|
| >TIGR01393 lepA GTP-binding protein LepA | Back alignment and domain information |
|---|
| >cd04118 Rab24 Rab24 subfamily | Back alignment and domain information |
|---|
| >cd04126 Rab20 Rab20 subfamily | Back alignment and domain information |
|---|
| >cd04101 RabL4 RabL4 (Rab-like4) subfamily | Back alignment and domain information |
|---|
| >cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily | Back alignment and domain information |
|---|
| >cd04153 Arl5_Arl8 Arl5/Arl8 subfamily | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >PRK13796 GTPase YqeH; Provisional | Back alignment and domain information |
|---|
| >cd04122 Rab14 Rab14 subfamily | Back alignment and domain information |
|---|
| >smart00178 SAR Sar1p-like members of the Ras-family of small GTPases | Back alignment and domain information |
|---|
| >cd04148 RGK RGK subfamily | Back alignment and domain information |
|---|
| >cd00876 Ras Ras family | Back alignment and domain information |
|---|
| >cd04142 RRP22 RRP22 subfamily | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >PTZ00133 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >PRK01889 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd04147 Ras_dva Ras-dva subfamily | Back alignment and domain information |
|---|
| >cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases | Back alignment and domain information |
|---|
| >cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd04132 Rho4_like Rho4-like subfamily | Back alignment and domain information |
|---|
| >TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH | Back alignment and domain information |
|---|
| >cd04110 Rab35 Rab35 subfamily | Back alignment and domain information |
|---|
| >cd04135 Tc10 TC10 subfamily | Back alignment and domain information |
|---|
| >TIGR00157 ribosome small subunit-dependent GTPase A | Back alignment and domain information |
|---|
| >smart00175 RAB Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd04133 Rop_like Rop subfamily | Back alignment and domain information |
|---|
| >cd04125 RabA_like RabA-like subfamily | Back alignment and domain information |
|---|
| >cd04108 Rab36_Rab34 Rab34/Rab36 subfamily | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >cd01866 Rab2 Rab2 subfamily | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >cd04120 Rab12 Rab12 subfamily | Back alignment and domain information |
|---|
| >COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04111 Rab39 Rab39 subfamily | Back alignment and domain information |
|---|
| >cd04130 Wrch_1 Wrch-1 subfamily | Back alignment and domain information |
|---|
| >PLN03110 Rab GTPase; Provisional | Back alignment and domain information |
|---|
| >cd00157 Rho Rho (Ras homology) family | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
| >cd01870 RhoA_like RhoA-like subfamily | Back alignment and domain information |
|---|
| >cd01875 RhoG RhoG subfamily | Back alignment and domain information |
|---|
| >TIGR00437 feoB ferrous iron transporter FeoB | Back alignment and domain information |
|---|
| >cd04113 Rab4 Rab4 subfamily | Back alignment and domain information |
|---|
| >cd04117 Rab15 Rab15 subfamily | Back alignment and domain information |
|---|
| >cd04121 Rab40 Rab40 subfamily | Back alignment and domain information |
|---|
| >PTZ00369 Ras-like protein; Provisional | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily | Back alignment and domain information |
|---|
| >cd04134 Rho3 Rho3 subfamily | Back alignment and domain information |
|---|
| >cd01874 Cdc42 Cdc42 subfamily | Back alignment and domain information |
|---|
| >cd04146 RERG_RasL11_like RERG/RasL11-like subfamily | Back alignment and domain information |
|---|
| >cd01667 TGS_ThrRS_N TGS _ThrRS_N: ThrRS (threonyl-tRNA Synthetase) is a class II tRNA synthetase that couples threonine to its cognate tRNA | Back alignment and domain information |
|---|
| >KOG0092|consensus | Back alignment and domain information |
|---|
| >cd04103 Centaurin_gamma Centaurin gamma | Back alignment and domain information |
|---|
| >cd04177 RSR1 RSR1 subgroup | Back alignment and domain information |
|---|
| >PRK06944 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >cd01873 RhoBTB RhoBTB subfamily | Back alignment and domain information |
|---|
| >PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PRK05659 sulfur carrier protein ThiS; Validated | Back alignment and domain information |
|---|
| >PRK09554 feoB ferrous iron transport protein B; Reviewed | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >cd00882 Ras_like_GTPase Ras-like GTPase superfamily | Back alignment and domain information |
|---|
| >PLN02799 Molybdopterin synthase sulfur carrier subunit | Back alignment and domain information |
|---|
| >cd01884 EF_Tu EF-Tu subfamily | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >TIGR01683 thiS thiamine biosynthesis protein ThiS | Back alignment and domain information |
|---|
| >PRK12317 elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily | Back alignment and domain information |
|---|
| >COG1162 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily | Back alignment and domain information |
|---|
| >cd04166 CysN_ATPS CysN_ATPS subfamily | Back alignment and domain information |
|---|
| >COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF02597 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiaminS) is a 66 aa protein involved in sulphur transfer | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >PLN03108 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >COG0218 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >PRK14845 translation initiation factor IF-2; Provisional | Back alignment and domain information |
|---|
| >cd00754 MoaD Ubiquitin domain of MoaD-like proteins | Back alignment and domain information |
|---|
| >PRK06437 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha | Back alignment and domain information |
|---|
| >smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 | Back alignment and domain information |
|---|
| >cd04131 Rnd Rnd subfamily | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PLN03071 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK04004 translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >TIGR02034 CysN sulfate adenylyltransferase, large subunit | Back alignment and domain information |
|---|
| >KOG0466|consensus | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >cd04104 p47_IIGP_like p47 (47-kDa) family | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0094|consensus | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >COG2914 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >cd01764 Urm1 Urm1-like ubuitin domain | Back alignment and domain information |
|---|
| >TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal | Back alignment and domain information |
|---|
| >cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily | Back alignment and domain information |
|---|
| >KOG0410|consensus | Back alignment and domain information |
|---|
| >TIGR01394 TypA_BipA GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >PLN00043 elongation factor 1-alpha; Provisional | Back alignment and domain information |
|---|
| >PRK08053 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >PRK08364 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >KOG0461|consensus | Back alignment and domain information |
|---|
| >KOG1423|consensus | Back alignment and domain information |
|---|
| >PRK10218 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00132 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >KOG0088|consensus | Back alignment and domain information |
|---|
| >COG1084 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >PRK07440 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11130 moaD molybdopterin synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >PF09138 Urm1: Urm1 (Ubiquitin related modifier); InterPro: IPR015221 Ubiquitin related modifier 1 (Urm1) is a ubiquitin related protein that modifies proteins in the yeast ubiquitin-like urmylation pathway [] | Back alignment and domain information |
|---|
| >PTZ00141 elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily | Back alignment and domain information |
|---|
| >PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily | Back alignment and domain information |
|---|
| >COG2104 ThiS Sulfur transfer protein involved in thiamine biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >KOG1191|consensus | Back alignment and domain information |
|---|
| >PRK06488 sulfur carrier protein ThiS; Validated | Back alignment and domain information |
|---|
| >PRK00413 thrS threonyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >KOG0083|consensus | Back alignment and domain information |
|---|
| >PRK07696 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily | Back alignment and domain information |
|---|
| >COG1977 MoaD Molybdopterin converting factor, small subunit [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1161 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0460|consensus | Back alignment and domain information |
|---|
| >PF14451 Ub-Mut7C: Mut7-C ubiquitin | Back alignment and domain information |
|---|
| >KOG0078|consensus | Back alignment and domain information |
|---|
| >cd04167 Snu114p Snu114p subfamily | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 123 | ||||
| 4a9a_A | 376 | Structure Of Rbg1 In Complex With Tma46 Dfrp Domain | 2e-41 | ||
| 2eki_A | 93 | Solution Structures Of The Tgs Domain Of Human Deve | 5e-31 |
| >pdb|4A9A|A Chain A, Structure Of Rbg1 In Complex With Tma46 Dfrp Domain Length = 376 | Back alignment and structure |
|
| >pdb|2EKI|A Chain A, Solution Structures Of The Tgs Domain Of Human Developmentally-Regulated Gtp-Binding Protein 1 Length = 93 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 123 | |||
| 2eki_A | 93 | DRG 1, developmentally-regulated GTP-binding prote | 5e-42 |
| >2eki_A DRG 1, developmentally-regulated GTP-binding protein 1; protein NEDD3, neural precursor cell expressed developmentally DOWN-regulated protein 3; NMR {Homo sapiens} Length = 93 | Back alignment and structure |
|---|
Score = 133 bits (335), Expect = 5e-42
Identities = 60/85 (70%), Positives = 67/85 (78%)
Query: 38 EKMWEYLKLTRIYTKPKGQLPDYQSPVVLHTDRRSIEDFCNKLHRTIAKEFKYALVWGSS 97
YLKL RIYTKPKGQLPDY SPVVL R ++EDFC K+H+ + KEFKYALVWG S
Sbjct: 3 SGSSGYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLS 62
Query: 98 VKHQPQKVGKEHVLNDEDVVQIVKK 122
VKH PQKVGK+H L DEDV+QIVKK
Sbjct: 63 VKHNPQKVGKDHTLEDEDVIQIVKK 87
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 123 | |||
| 2eki_A | 93 | DRG 1, developmentally-regulated GTP-binding prote | 100.0 | |
| 4a9a_A | 376 | Ribosome-interacting GTPase 1; DRG-DFRP complex, r | 100.0 | |
| 2dby_A | 368 | GTP-binding protein; GDP, structural genomics, NPP | 99.92 | |
| 1wxq_A | 397 | GTP-binding protein; structural genomics, riken st | 99.91 | |
| 1jal_A | 363 | YCHF protein; nucleotide-binding fold, structural | 99.9 | |
| 2ohf_A | 396 | Protein OLA1, GTP-binding protein 9; ATPase, GTPas | 99.89 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 99.87 | |
| 3hvz_A | 78 | Uncharacterized protein; alpha-beta protein, struc | 99.32 | |
| 2kmm_A | 73 | Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohy | 98.11 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 98.07 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 97.98 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 97.32 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 97.26 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 97.24 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 97.11 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 97.07 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 97.06 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 97.04 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 97.04 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 97.02 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 97.01 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 97.0 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 97.0 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 97.0 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 96.99 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 96.99 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 96.98 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 96.95 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 96.94 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 96.94 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 96.93 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 96.93 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 96.93 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 96.91 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 96.91 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 96.9 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 96.9 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 96.89 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 96.88 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 96.87 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 96.87 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 96.85 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 96.84 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 96.84 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 96.83 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 96.83 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 96.82 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 96.81 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 96.81 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 96.81 | |
| 1wwt_A | 88 | Threonyl-tRNA synthetase, cytoplasmic; TGS domain, | 96.8 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 96.8 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 96.8 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 96.79 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 96.79 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 96.77 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 96.76 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 96.75 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 96.75 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 96.74 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 96.74 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 96.73 | |
| 2hj1_A | 97 | Hypothetical protein; structural genomics, PSI, pr | 96.73 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 96.72 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 96.72 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 96.7 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 96.69 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 96.69 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 96.69 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 96.69 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 96.68 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 96.68 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 96.67 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 96.67 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 96.66 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 96.64 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 96.64 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 96.62 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 96.6 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 96.59 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 96.59 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 96.59 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 96.59 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 96.59 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 96.58 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 96.58 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 96.58 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 96.57 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 96.56 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 96.54 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 96.54 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 96.54 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 96.54 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 96.52 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 96.52 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 96.51 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 96.49 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 96.49 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 96.48 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 96.48 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 96.47 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 96.46 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 96.45 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 96.44 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 96.44 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 96.43 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 96.43 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 96.42 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 96.42 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 96.41 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 96.4 | |
| 1tke_A | 224 | Threonyl-tRNA synthetase; ligase; 1.46A {Escherich | 96.37 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 96.36 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 96.36 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 96.36 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 96.35 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 96.33 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 96.32 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 96.32 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 96.3 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 96.3 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 96.27 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 96.25 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 96.25 | |
| 3c5h_A | 255 | Glucocorticoid receptor DNA-binding factor 1; RAS, | 96.2 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 96.18 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 96.18 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 96.13 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 96.12 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 96.12 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 96.12 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 96.06 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 96.06 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 96.02 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 96.02 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 96.01 | |
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 95.99 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 95.92 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 95.89 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 95.89 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 94.88 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 95.87 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 95.86 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 95.85 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 95.83 | |
| 3j2k_7 | 439 | ERF3, eukaryotic polypeptide chain release factor | 95.8 | |
| 3cb4_D | 599 | GTP-binding protein LEPA; GTPase, OB-fold, membran | 95.78 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 95.76 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 95.75 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 95.72 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 95.62 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 95.62 | |
| 2ywe_A | 600 | GTP-binding protein LEPA; G domain, beta-barrel, f | 95.6 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 95.55 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 95.53 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 95.5 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 95.46 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 95.46 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 95.39 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 95.32 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 95.24 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 95.19 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 95.17 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 95.1 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 95.06 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 95.01 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 95.01 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 94.99 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 94.85 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 94.72 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 94.68 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 94.53 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 94.47 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 94.44 | |
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 94.4 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 94.25 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 94.23 | |
| 2q5w_D | 77 | Molybdopterin converting factor, subunit 1; MOCO, | 94.19 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 94.02 | |
| 1vjk_A | 98 | Molybdopterin converting factor, subunit 1; struct | 93.8 | |
| 3po0_A | 89 | Small archaeal modifier protein 1; ubiquitin-like | 93.56 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 93.41 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 92.78 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 92.67 | |
| 2g1e_A | 90 | Hypothetical protein TA0895; MOAD, molybdopterin, | 92.66 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 92.42 | |
| 2cu3_A | 64 | Unknown function protein; thermus thermophilus HB8 | 92.22 | |
| 1ryj_A | 70 | Unknown; beta/alpha protein, structural genomics, | 92.18 | |
| 1rws_A | 77 | Hypothetical protein PF1061; residual dipolar coup | 91.93 | |
| 1f0z_A | 66 | THis protein; ubiquitin fold, transport protein; N | 91.84 | |
| 1zo1_I | 501 | IF2, translation initiation factor 2; E. coli, rib | 91.79 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 91.71 | |
| 3rpf_C | 74 | Molybdopterin converting factor, subunit 1 (MOAD); | 91.48 | |
| 1jny_A | 435 | EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- | 91.14 | |
| 1fm0_D | 81 | Molybdopterin convertin factor, subunit 1; molybde | 90.95 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 90.71 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 90.54 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 90.3 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 89.55 | |
| 2x2e_A | 353 | Dynamin-1; nitration, hydrolase, membrane fission, | 89.52 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 89.3 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 89.29 | |
| 2k5p_A | 78 | THis protein, thiamine-biosynthesis protein; NESG, | 88.89 | |
| 1f60_A | 458 | Elongation factor EEF1A; protein-protein complex, | 88.61 | |
| 1tyg_B | 87 | YJBS; alpha beta barrel, protein-protein complex, | 87.42 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 87.08 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 85.69 | |
| 2k9x_A | 110 | Tburm1, uncharacterized protein; unknown function; | 85.28 | |
| 2l52_A | 99 | Methanosarcina acetivorans SAMP1 homolog; beta-grA | 84.61 | |
| 2qjl_A | 99 | URM1, ubiquitin-related modifier 1; ubiquitin-like | 83.38 | |
| 2kl0_A | 73 | Putative thiamin biosynthesis THis; structural gen | 83.33 | |
| 3r7w_A | 307 | Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT | 83.08 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 81.46 | |
| 3dwg_C | 93 | 9.5 kDa culture filtrate antigen CFP10A; sulfur ca | 80.32 |
| >2eki_A DRG 1, developmentally-regulated GTP-binding protein 1; protein NEDD3, neural precursor cell expressed developmentally DOWN-regulated protein 3; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=4.7e-39 Score=216.67 Aligned_cols=81 Identities=73% Similarity=1.201 Sum_probs=79.0
Q ss_pred HHhhccceEEeCCCCCCCCCcccEEE-eCCCCCHHHHHHHhHHHHHhhcceeEEecCCCCCCCceeCCCceecCCCeEEE
Q psy2927 41 WEYLKLTRIYTKPKGQLPDYQSPVVL-HTDRRSIEDFCNKLHRTIAKEFKYALVWGSSVKHQPQKVGKEHVLNDEDVVQI 119 (123)
Q Consensus 41 ~~~L~~irvytk~~g~~pd~~~~~~l-~~g~~tv~d~a~~IH~d~~~~f~~A~vwg~s~k~~~q~vg~~~~l~d~Dvv~i 119 (123)
|+.|++||||||++|+.||+.+|++| |+| +||+|+|++||++|.++|+||+|||+|+||+|||||++|+|+|||||+|
T Consensus 6 ~~~L~lIrVYtk~~G~~pd~~dpviL~~~G-sTv~Dfa~~IH~di~~~fkyA~VwG~saK~~~qrVgldh~L~d~DVV~I 84 (93)
T 2eki_A 6 SGYLKLVRIYTKPKGQLPDYTSPVVLPYSR-TTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQI 84 (93)
T ss_dssp SSSCCEEEEEECCTTSCCCSSSCEEEETTS-CCHHHHHHHHCTTCTTTEEEEEEBSTTSSSSSEEECSSCCCCSSEEECE
T ss_pred hhhcCeEEEEeCCCCCCCCCCCCEEEecCC-CCHHHHHHHHHHHHHhhccEEEEecccccCCCEECCCCcEecCCCEEEE
Confidence 78999999999999999999999999 887 9999999999999999999999999999999999999999999999999
Q ss_pred Eec
Q psy2927 120 VKK 122 (123)
Q Consensus 120 ~~~ 122 (123)
+++
T Consensus 85 v~~ 87 (93)
T 2eki_A 85 VKK 87 (93)
T ss_dssp EEC
T ss_pred EeC
Confidence 986
|
| >4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A | Back alignment and structure |
|---|
| >1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >3hvz_A Uncharacterized protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.20A {Clostridium leptum} | Back alignment and structure |
|---|
| >2kmm_A Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohydrolase; methods development, TGS domain, predominantly beta-sheet structure; NMR {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1wwt_A Threonyl-tRNA synthetase, cytoplasmic; TGS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >2hj1_A Hypothetical protein; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; 2.10A {Haemophilus influenzae} SCOP: d.15.3.4 | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1tke_A Threonyl-tRNA synthetase; ligase; 1.46A {Escherichia coli} SCOP: d.15.10.1 d.67.1.1 PDB: 1tje_A 1tkg_A* 1tky_A* | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >2q5w_D Molybdopterin converting factor, subunit 1; MOCO, MPT synthase, MOAD, MOAE, transferase, molybdenum cofactor biosynthesis; 2.00A {Staphylococcus aureus} PDB: 2qie_B* | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 | Back alignment and structure |
|---|
| >3po0_A Small archaeal modifier protein 1; ubiquitin-like protein, protein binding; 1.55A {Haloferax volcanii} PDB: 2l83_A | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2g1e_A Hypothetical protein TA0895; MOAD, molybdopterin, transferase; NMR {Thermoplasma acidophilum} PDB: 2k22_A | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2cu3_A Unknown function protein; thermus thermophilus HB8, structural genomics, riken structu genomics/proteomics initiative, RSGI, NPPSFA; 1.70A {Thermus thermophilus} SCOP: d.15.3.2 PDB: 2htm_E | Back alignment and structure |
|---|
| >1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 | Back alignment and structure |
|---|
| >1rws_A Hypothetical protein PF1061; residual dipolar couplings, structural genomics, unknown FUN; NMR {Pyrococcus furiosus} SCOP: d.15.3.2 PDB: 1sf0_A | Back alignment and structure |
|---|
| >1f0z_A THis protein; ubiquitin fold, transport protein; NMR {Escherichia coli} SCOP: d.15.3.2 PDB: 1zud_2 | Back alignment and structure |
|---|
| >1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* | Back alignment and structure |
|---|
| >1fm0_D Molybdopterin convertin factor, subunit 1; molybdenum cofactor biosynthesis, transferase; 1.45A {Escherichia coli} SCOP: d.15.3.1 PDB: 1fma_D 1jw9_D 1jwa_D* 1jwb_D* 3bii_D 1nvi_D | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >2k5p_A THis protein, thiamine-biosynthesis protein; NESG, GMR137, structural genomics, PSI-2, protein structure initiative; NMR {Geobacter metallireducens gs-15} PDB: 3cwi_A | Back alignment and structure |
|---|
| >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A | Back alignment and structure |
|---|
| >1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2k9x_A Tburm1, uncharacterized protein; unknown function; NMR {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2l52_A Methanosarcina acetivorans SAMP1 homolog; beta-grAsp fold, protein binding, E1-like, SAMP activator, ELSA, adenylation, ubiquitin; NMR {Methanosarcina acetivorans} | Back alignment and structure |
|---|
| >2qjl_A URM1, ubiquitin-related modifier 1; ubiquitin-like protein, signaling protein; 1.44A {Saccharomyces cerevisiae} PDB: 2pko_A 2ax5_A | Back alignment and structure |
|---|
| >3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 123 | ||||
| d1wxqa2 | 76 | d.15.10.2 (A:320-395) GTP-binding protein PH0525 { | 4e-09 |
| >d1wxqa2 d.15.10.2 (A:320-395) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Length = 76 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: TGS-like family: G domain-linked domain domain: GTP-binding protein PH0525 species: Pyrococcus horikoshii [TaxId: 53953]
Score = 47.8 bits (114), Expect = 4e-09
Identities = 18/72 (25%), Positives = 32/72 (44%), Gaps = 10/72 (13%)
Query: 50 YTKPKGQ-LPDYQSPVVLHTDRRSIEDFCNKLHRTIAKEFKYALVWGSSVKHQPQKVGKE 108
T G LP ++ + D K+H + K F YA+ + ++VG++
Sbjct: 12 LTDQFGNVLPH---VFLMK-KGSTPRDLAFKVHTDLGKGFLYAINARTK-----RRVGED 62
Query: 109 HVLNDEDVVQIV 120
+ L D+V+IV
Sbjct: 63 YELQFNDIVKIV 74
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 123 | |||
| d1wxqa2 | 76 | GTP-binding protein PH0525 {Pyrococcus horikoshii | 99.87 | |
| d1ni3a2 | 82 | YchF GTP-binding protein, C-terminal domain {Fissi | 99.65 | |
| d1jala2 | 85 | YchF GTP-binding protein, C-terminal domain {Haemo | 99.63 | |
| d1tkea1 | 62 | Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi | 98.5 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 98.23 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 98.22 | |
| d1nyra2 | 59 | Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi | 98.2 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 98.12 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 97.96 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 97.94 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 97.82 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 97.8 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 97.79 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 97.77 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 97.65 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 97.62 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 97.58 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 97.54 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 97.29 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 97.29 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 97.18 | |
| d2hj1a1 | 77 | Hypothetical protein HI0395 {Haemophilus influenza | 97.06 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 96.99 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 96.89 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 96.77 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 96.76 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 96.7 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 96.69 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 96.68 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 96.66 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 96.64 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 96.52 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 96.51 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 96.5 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 96.45 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 96.34 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 96.33 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 96.32 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 96.24 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 96.24 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 96.14 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 96.13 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 96.13 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 96.12 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 96.11 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 96.09 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 96.06 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 95.98 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 95.93 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 95.91 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 95.91 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 95.88 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 95.81 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 95.77 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 95.72 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 95.65 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 95.52 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 95.51 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 95.45 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 95.28 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 95.15 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 95.0 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 94.96 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 94.91 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 94.9 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 94.76 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 94.73 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 94.71 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 94.54 | |
| d1vjka_ | 88 | Molybdopterin synthase subunit MoaD {Pyrococcus fu | 94.53 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 94.11 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 94.1 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 94.09 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 94.02 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 93.69 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 93.41 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 92.29 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 92.03 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 91.9 | |
| d1xo3a_ | 101 | C9orf74 homolog {Mouse (Mus musculus) [TaxId: 1009 | 91.19 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 91.1 | |
| d1wxqa1 | 319 | GTP-binding protein PH0525 {Pyrococcus horikoshii | 90.84 | |
| d1zud21 | 65 | Thiamin biosynthesis sulfur carrier protein ThiS { | 89.39 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 89.34 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 88.85 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 81.33 |
| >d1wxqa2 d.15.10.2 (A:320-395) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: TGS-like family: G domain-linked domain domain: GTP-binding protein PH0525 species: Pyrococcus horikoshii [TaxId: 53953]
Probab=99.87 E-value=1e-22 Score=131.03 Aligned_cols=65 Identities=28% Similarity=0.443 Sum_probs=56.2
Q ss_pred eEEeCCCCC-CCCCcccEEEeCCCCCHHHHHHHhHHHHHhhcceeEEecCCCCCCCceeCCCceecCCCeEEEEe
Q psy2927 48 RIYTKPKGQ-LPDYQSPVVLHTDRRSIEDFCNKLHRTIAKEFKYALVWGSSVKHQPQKVGKEHVLNDEDVVQIVK 121 (123)
Q Consensus 48 rvytk~~g~-~pd~~~~~~l~~g~~tv~d~a~~IH~d~~~~f~~A~vwg~s~k~~~q~vg~~~~l~d~Dvv~i~~ 121 (123)
+-|++++|+ .|| +++||+| ||+.|+|++||+||+++|++|++|+ +||++|++|+|+|||+|+|+|
T Consensus 10 ~~~~~~~g~vl~D---~~~Lp~G-sTv~D~A~~IH~dlg~~~~~A~~~~-----~g~~v~l~~~L~dgDvVeIiT 75 (76)
T d1wxqa2 10 NKLTDQFGNVLPH---VFLMKKG-STPRDLAFKVHTDLGKGFLYAINAR-----TKRRVGEDYELQFNDIVKIVS 75 (76)
T ss_dssp -----CCSCSSCC---CEEEETT-CCHHHHHHHHCHHHHHTEEEEEETT-----TCSBCCTTCCCCTTEEEEEEE
T ss_pred CEEECCCCCCccc---cEEeCCC-CcHHHHHHHHhHHHHhheEEEEECc-----CCEECCCCcCccCCCEEEEEE
Confidence 445678887 687 9999998 9999999999999999999999876 579999999999999999997
|
| >d1ni3a2 d.15.10.2 (A:307-388) YchF GTP-binding protein, C-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1jala2 d.15.10.2 (A:279-363) YchF GTP-binding protein, C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1tkea1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nyra2 d.15.10.1 (A:4-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2hj1a1 d.15.3.4 (A:11-87) Hypothetical protein HI0395 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1zud21 d.15.3.2 (2:2-66) Thiamin biosynthesis sulfur carrier protein ThiS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|