Diaphorina citri psyllid: psy2937


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MYRMAVMTFLLDENNETKLNRTRCMELALLHDMAECIVGDLTPYCGVSKEEKHRREDLIKRCMELALLHDMAECIVGDLTPYCGVSKEEKHRREDEAMKTLKSLCHTQGDRMYTLFQEYESQETPEAKFVKELDIVDMLVQAFEYEKAQHIDLSEFFVPERYTFVFPLTKSMNEELEYESQETPEAKFVKELDIVDMLVQAFEYEKAQHIDLSEFFVPERYTFVFPLTKSMNEELVKQRNELIRNKTTQNGTIKNAS
ccHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcHHHcccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHccccHHccHHHHHHHHHHHHHHHHHHccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccc
*YRMAVMTFLLDENNETKLNRTRCMELALLHDMAECIVGDLTPYCGVSKEEKHRREDLIKRCMELALLHDMAECIVGDLTPYCGVSKEEKHRREDEAMKTLKSLCHTQGDRMYTLFQEYESQETPEAKFVKELDIVDMLVQAFEYEKAQHIDLSEFFVPERYTFVFPLTKSMNEELEYESQETPEAKFVKELDIVDMLVQAFEYEKAQHIDLSEFFVPERYTFVFPLTKSMNEELVKQRN*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYRMAVMTFLLDENNETKLNRTRCMELALLHDMAECIVGDLTPYCGVSKEEKHRREDLIKRCMELALLHDMAECIVGDLTPYCGVSKEEKHRREDEAMKTLKSLCHTQGDRMYTLFQEYESQETPEAKFVKELDIVDMLVQAFEYEKAQHIDLSEFFVPERYTFVFPLTKSMNEELEYESQETPEAKFVKELDIVDMLVQAFEYEKAQHIDLSEFFVPERYTFVFPLTKSMNEELVKQRNELIRNKTTQNGTIKNAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
HD domain-containing protein 2 confidentQ1LUI2
HD domain-containing protein C4G3.17 confidentP87242

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DMB, chain A
Confidence level:very confident
Coverage over the Query: 10-41,80-119,179-248
View the alignment between query and template
View the model in PyMOL
Template: 3KH1, chain A
Confidence level:very confident
Coverage over the Query: 1-42,81-175
View the alignment between query and template
View the model in PyMOL