Diaphorina citri psyllid: psy2960

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-----

MKQVKGLFMNVFKTYQAGSLRFISSKKLVFHEFGEPAKVVNVVEEELLKVMSTELCTYISLLDTSARGFSYLANKLVYNQHGTPLRVVTVENETLNSVQKHEVVVKMLVAPVNPADINTIQGVYPIKPTLPAVPGFEGVGEVVEVGSDVSSLAVGDHVIPDTQHLGTWRNYGKFNHDVLMKVPKDIALTEISGITSNPCTAYRMLKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGADYVFTEEELRNISRDASIPKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSREPVQIPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTEMMRTGKLAAPAHKFVTLKNFQEALMNTMSIQGKSGVKYYIDFRQ

ccccccHHHHHHHHHccccEEEEcccccHHHHcccccccHHHHHHHHHHHHHHccHHHHHHcccccccccccEEEEEEcccccccccEEEEEEccccccccEEEEEEEEEccccHHHHHHccccccccccccccccCEEEEEEEEcccccccccccEEEEccccccccccEEEcccccEEEccccccHHHHHcccccHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccccCEEcHHHHHHHHHHcccccccEEEEccccHHHHHHHHccccccEEEEECcccccccccccccHHccccEEEEEEccccccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccEEEEEEEcc

****KGLFMNVFKTYQAGSLRFISSKKLVFHEFGEPAKVVNVVEEELLKVMSTELCTYISLLDTSARGFSYLANKLVYNQHGTPLRVVTVENETLNSVQKHEVVVKMLVAPVNPADINTIQGVYPIKPTLPAVPGFEGVGEVVEVGSDVSSLAVGDHVIPDTQHLGTWRNYGKFNHDVLMKVPKDIALTEISGITSNPCTAYRMLKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGADYVFTEEELRNISRDASIPKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSREPVQIPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTEMMRTGKLAAPAHKFVTLKNFQEALMNTMSIQGKSGVKYYIDFRQ

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable trans-2-enoyl-CoA reductase, mitochondrial	Catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA. May have a role in the mitochondrial synthesis of fatty acids.	very confident	Q9V6U9
Trans-2-enoyl-CoA reductase, mitochondrial	Catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA with chain length from C6 to C16 in an NADPH-dependent manner with preference to medium chain length substrate. May have a role in the mitochondrial synthesis of fatty acids.	confident	Q9DCS3
Trans-2-enoyl-CoA reductase, mitochondrial	Catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA with chain length from C6 to C16 in an NADPH-dependent manner with preference to medium chain length substrate. May have a role in the mitochondrial synthesis of fatty acids.	confident	Q9BV79

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044424 [CC]	intracellular part	confident	GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005507 [MF]	copper ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0009507 [CC]	chloroplast	probable	GO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006633 [BP]	fatty acid biosynthetic process	probable	GO:0006631, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237
GO:0005102 [MF]	receptor binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0033554 [BP]	cellular response to stress	probable	GO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0008150, GO:0044699
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0019166 [MF]	trans-2-enoyl-CoA reductase (NADPH) activity	probable	GO:0003824, GO:0016627, GO:0003674, GO:0016628, GO:0016491
GO:0009060 [BP]	aerobic respiration	probable	GO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0045333, GO:0008152, GO:0008150, GO:0006091, GO:0055114

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
1.-.-.-	Oxidoreductases.	probable
1.3.-.-	Acting on the CH-CH group of donors.	probable
1.3.1.-	10-hydroxytaxane O-acetyltransferase.	probable
1.3.1.38	Trans-2-enoyl-CoA reductase (NADPH).	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZSY, chain A
Confidence level:very confident
Coverage over the Query: 66-403
View the alignment between query and template
View the model in PyMOL

Template: 3SLK, chain A
Confidence level:very confident
Coverage over the Query: 36-404
View the alignment between query and template
View the model in PyMOL