Diaphorina citri psyllid: psy2961


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
MLKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGADYVFTEEELRNISRDASIPKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSREPVQIPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTEMMRTGKLAAPAHKFVTLKNFQEALMNTMSIQGKSGVKYYIDFRQ
ccccccccccccEEEECccccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccccEEEcHHHHHHHHHHccccccEEEEcccccHHHHHHHHHcccccEEEECccccccccccccccHHccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHccccccccccEEccHHHHHHHHHHHHHcccccEEEEEEEcc
MLKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGADYVFTEEELRNISRDASIPKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSREPVQIPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTEMMRTGKLAAPAHKFVTLKNFQEALMNTMSIQGKSGVKYYIDFRQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGADYVFTEEELRNISRDASIPKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSREPVQIPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTEMMRTGKLAAPAHKFVTLKNFQEALMNTMSIQGKSGVKYYIDFRQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Trans-2-enoyl-CoA reductase, mitochondrial Catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA with chain length from C6 to C16 in an NADPH-dependent manner with preference to medium chain length substrate. May have a role in the mitochondrial synthesis of fatty acids.confidentQ9DCS3
Probable trans-2-enoyl-CoA reductase, mitochondrial Catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA. May have a role in the mitochondrial synthesis of fatty acids.confidentQ9V6U9
Trans-2-enoyl-CoA reductase, mitochondrial Catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA with chain length from C6 to C16 in an NADPH-dependent manner with preference to medium chain length substrate. May have a role in the mitochondrial synthesis of fatty acids.confidentQ9Z311

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006631 [BP]fatty acid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0006082, GO:0009987, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0019166 [MF]trans-2-enoyl-CoA reductase (NADPH) activityprobableGO:0003824, GO:0016627, GO:0003674, GO:0016628, GO:0016491

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZSY, chain A
Confidence level:very confident
Coverage over the Query: 2-200
View the alignment between query and template
View the model in PyMOL