Psyllid ID: psy2961


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
MLKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGADYVFTEEELRNISRDASIPKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSREPVQIPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTEMMRTGKLAAPAHKFVTLKNFQEALMNTMSIQGKSGVKYYIDFRQ
ccccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccccEEEcHHHHHHHHHHccccccEEEEcccccHHHHHHHHHcccccEEEEEccccccccccccccHHccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHccccccccccEEccHHHHHHHHHHHHHcccccEEEEEEEcc
ccHHHHccccccEEEEccccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHccccEEEEHHHHHHHHHHccccccEEEEEcccHHHHHHHHHccccccEEEEccccccccEEEcHHHHHHcccEEEEccHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccccEEEEEEEccc
mlkdynslspgdvviqngansacgQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSlgadyvftEEELRNisrdasipkpklalncvggnsaTNLLRTLVSKGVMvtyggmsrepvqiptsafifkdiTLRGHWMTRWQKENKESAERKSMMNELTEMMRTgklaapahkFVTLKNFQEALMNTMSIQGKSGVKYYIDFRQ
mlkdynslspGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGADYVFTEEELRnisrdasipkpkLALNCVGGNSATNLLRTLVSKGVMVTYGGmsrepvqiptsaFIFKDITLRGHWMtrwqkenkesaeRKSMMNELTEMMRTGKLAAPAHKFVTLKNFQEALMNTmsiqgksgvKYYIDFRQ
MLKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGADYVFTEEELRNISRDASIPKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSREPVQIPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTEMMRTGKLAAPAHKFVTLKNFQEALMNTMSIQGKSGVKYYIDFRQ
************VVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGADYVFTEEELRNISRDASIPKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSREPVQIPTSAFIFKDITLRGHWMTRW**************************AAPAHKFVTLKNFQEALMNTMSIQGKSGVKYYID***
MLKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGADYVFTEEELRNISRDASIPKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSREPVQIPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTEMMRTGKLAAPAHKFVTLKNFQEALMNTMSIQGKSGVKYYIDFRQ
MLKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGADYVFTEEELRNISRDASIPKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSREPVQIPTSAFIFKDITLRGHWMTRWQK*********SMMNELTEMMRTGKLAAPAHKFVTLKNFQEALMNTMSIQGKSGVKYYIDFRQ
MLKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGADYVFTEEELRNISRDASIPKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSREPVQIPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTEMMRTGKLAAPAHKFVTLKNFQEALMNTMSIQGKSGVKYYIDFRQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGADYVFTEEELRNISRDASIPKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSREPVQIPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTEMMRTGKLAAPAHKFVTLKNFQEALMNTMSIQGKSGVKYYIDFRQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query202 2.2.26 [Sep-21-2011]
Q9V6U9357 Probable trans-2-enoyl-Co yes N/A 0.985 0.557 0.527 1e-56
Q9Z311373 Trans-2-enoyl-CoA reducta yes N/A 0.905 0.490 0.528 3e-50
Q9BV79373 Trans-2-enoyl-CoA reducta no N/A 0.905 0.490 0.513 7e-49
Q9DCS3373 Trans-2-enoyl-CoA reducta yes N/A 0.905 0.490 0.523 8e-49
Q6GQN8377 Trans-2-enoyl-CoA reducta yes N/A 0.920 0.493 0.5 3e-48
Q28GQ2350 Trans-2-enoyl-CoA reducta yes N/A 0.925 0.534 0.468 5e-46
Q7YS70373 Trans-2-enoyl-CoA reducta yes N/A 0.896 0.485 0.475 1e-43
O45903344 Probable trans-2-enoyl-Co yes N/A 0.806 0.473 0.533 4e-43
Q54YT4350 Trans-2-enoyl-CoA reducta yes N/A 0.965 0.557 0.417 1e-38
Q8LCU7375 Probable trans-2-enoyl-Co yes N/A 0.935 0.504 0.432 5e-38
>sp|Q9V6U9|MECR_DROME Probable trans-2-enoyl-CoA reductase, mitochondrial OS=Drosophila melanogaster GN=CG16935 PE=3 SV=2 Back     alignment and function desciption
 Score =  219 bits (557), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 106/201 (52%), Positives = 133/201 (66%), Gaps = 2/201 (0%)

Query: 1   MLKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGA 60
           MLKD+  L PGD VIQNGANSA GQ V Q+ R WG+ ++ IVR+R +I +LK  L+ LGA
Sbjct: 154 MLKDFVQLCPGDTVIQNGANSAVGQAVHQLCRAWGINSVGIVRDRPEIAELKQMLQCLGA 213

Query: 61  DYVFTEEELR--NISRDASIPKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSREPVQ 118
             V TE E+R  +I +   + KP+LA NCVGG SAT + R L + GV+VTYGGMSREPV 
Sbjct: 214 TEVLTEAEIRTSDIFKSGKLKKPRLAFNCVGGKSATEVSRHLDNGGVLVTYGGMSREPVT 273

Query: 119 IPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTEMMRTGKLAAPAHKFVTLKNF 178
           + T   IFKDI  RG WMTRW KEN  S ER  M  E+ E+M  GK  AP H+ V L  F
Sbjct: 274 VATGPLIFKDIAFRGFWMTRWSKENYSSPERSKMFKEIFELMEQGKFVAPNHEMVPLAKF 333

Query: 179 QEALMNTMSIQGKSGVKYYID 199
           ++A    +S +G +G KY +D
Sbjct: 334 KDAAAAALSFKGFTGKKYILD 354




Catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA. May have a role in the mitochondrial synthesis of fatty acids.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 3EC: .EC: 1EC: .EC: 3EC: 8
>sp|Q9Z311|MECR_RAT Trans-2-enoyl-CoA reductase, mitochondrial OS=Rattus norvegicus GN=Mecr PE=2 SV=1 Back     alignment and function description
>sp|Q9BV79|MECR_HUMAN Trans-2-enoyl-CoA reductase, mitochondrial OS=Homo sapiens GN=MECR PE=1 SV=2 Back     alignment and function description
>sp|Q9DCS3|MECR_MOUSE Trans-2-enoyl-CoA reductase, mitochondrial OS=Mus musculus GN=Mecr PE=2 SV=2 Back     alignment and function description
>sp|Q6GQN8|MECR_DANRE Trans-2-enoyl-CoA reductase, mitochondrial OS=Danio rerio GN=mecr PE=2 SV=2 Back     alignment and function description
>sp|Q28GQ2|MECR_XENTR Trans-2-enoyl-CoA reductase, mitochondrial OS=Xenopus tropicalis GN=mecr PE=2 SV=1 Back     alignment and function description
>sp|Q7YS70|MECR_BOVIN Trans-2-enoyl-CoA reductase, mitochondrial OS=Bos taurus GN=MECR PE=1 SV=1 Back     alignment and function description
>sp|O45903|MECR1_CAEEL Probable trans-2-enoyl-CoA reductase 1, mitochondrial OS=Caenorhabditis elegans GN=W09H1.5 PE=3 SV=1 Back     alignment and function description
>sp|Q54YT4|MECR_DICDI Trans-2-enoyl-CoA reductase, mitochondrial OS=Dictyostelium discoideum GN=mecr PE=3 SV=1 Back     alignment and function description
>sp|Q8LCU7|MECR_ARATH Probable trans-2-enoyl-CoA reductase, mitochondrial OS=Arabidopsis thaliana GN=At3g45770 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
91089675 360 PREDICTED: similar to zinc binding dehyd 0.995 0.558 0.576 7e-65
193629721 367 PREDICTED: probable trans-2-enoyl-CoA re 0.995 0.547 0.565 2e-61
389612198 364 zinc binding dehydrogenase [Papilio xuth 0.985 0.546 0.579 4e-61
383865671 370 PREDICTED: probable trans-2-enoyl-CoA re 0.990 0.540 0.529 3e-59
332374884 365 unknown [Dendroctonus ponderosae] 0.990 0.547 0.529 4e-59
157104018 353 zinc binding dehydrogenase [Aedes aegypt 0.990 0.566 0.539 5e-59
312381828 364 hypothetical protein AND_05789 [Anophele 0.990 0.549 0.544 5e-59
195123621 340 GI20971 [Drosophila mojavensis] gi|19391 1.0 0.594 0.539 6e-59
340709598 370 PREDICTED: probable trans-2-enoyl-CoA re 1.0 0.545 0.509 4e-58
350401046 370 PREDICTED: probable trans-2-enoyl-CoA re 1.0 0.545 0.509 5e-58
>gi|91089675|ref|XP_974428.1| PREDICTED: similar to zinc binding dehydrogenase [Tribolium castaneum] gi|270012629|gb|EFA09077.1| hypothetical protein TcasGA2_TC006794 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 117/203 (57%), Positives = 151/203 (74%), Gaps = 2/203 (0%)

Query: 1   MLKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGA 60
           ML+D+  L PGD VIQNGANSACGQNVIQI R WGL+++NIVR+R  ID+L+ +L++LGA
Sbjct: 158 MLRDFVDLKPGDTVIQNGANSACGQNVIQICRAWGLRSVNIVRDRAGIDELRCFLQNLGA 217

Query: 61  DYVFTEEELR--NISRDASIPKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSREPVQ 118
           ++V TEEELR   I +   + KPKLALNCVGG +A  ++R L   G MVTYGGMSREPV 
Sbjct: 218 NHVLTEEELRKTEIFKSGKLEKPKLALNCVGGQNALEVMRHLDKGGTMVTYGGMSREPVT 277

Query: 119 IPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTEMMRTGKLAAPAHKFVTLKNF 178
           +PTSA IFKD+ +RG WMT W K+N +S +R  M  EL  MM T +L  PA K V+ + +
Sbjct: 278 VPTSALIFKDLRIRGFWMTDWTKQNADSVDRFEMFEELISMMTTNELQGPAFKMVSFEQY 337

Query: 179 QEALMNTMSIQGKSGVKYYIDFR 201
           +EALMNTM+I+G  G KY ++F+
Sbjct: 338 KEALMNTMTIKGMIGKKYILEFK 360




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|193629721|ref|XP_001949333.1| PREDICTED: probable trans-2-enoyl-CoA reductase, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|389612198|dbj|BAM19614.1| zinc binding dehydrogenase [Papilio xuthus] Back     alignment and taxonomy information
>gi|383865671|ref|XP_003708296.1| PREDICTED: probable trans-2-enoyl-CoA reductase, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332374884|gb|AEE62583.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|157104018|ref|XP_001648220.1| zinc binding dehydrogenase [Aedes aegypti] gi|108880436|gb|EAT44661.1| AAEL003995-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|312381828|gb|EFR27478.1| hypothetical protein AND_05789 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|195123621|ref|XP_002006302.1| GI20971 [Drosophila mojavensis] gi|193911370|gb|EDW10237.1| GI20971 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|340709598|ref|XP_003393392.1| PREDICTED: probable trans-2-enoyl-CoA reductase, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350401046|ref|XP_003486037.1| PREDICTED: probable trans-2-enoyl-CoA reductase, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
FB|FBgn0033883357 CG16935 [Drosophila melanogast 0.985 0.557 0.527 1.9e-51
RGD|3208373 Mecr "mitochondrial trans-2-en 0.905 0.490 0.528 4.4e-45
UNIPROTKB|Q9Z311373 Mecr "Trans-2-enoyl-CoA reduct 0.905 0.490 0.528 4.4e-45
UNIPROTKB|Q9BV79373 MECR "Trans-2-enoyl-CoA reduct 0.905 0.490 0.513 2.4e-44
MGI|MGI:1349441373 Mecr "mitochondrial trans-2-en 0.905 0.490 0.523 1.3e-43
ZFIN|ZDB-GENE-050417-399377 mecr "mitochondrial trans-2-en 0.920 0.493 0.5 1.7e-43
UNIPROTKB|E2R1T2367 MECR "Uncharacterized protein" 0.905 0.498 0.497 3.2e-42
UNIPROTKB|Q28GQ2350 mecr "Trans-2-enoyl-CoA reduct 0.925 0.534 0.463 3.2e-42
WB|WBGene00012375344 mecr-1 [Caenorhabditis elegans 0.806 0.473 0.533 4.2e-40
UNIPROTKB|Q7YS70373 MECR "Trans-2-enoyl-CoA reduct 0.896 0.485 0.475 1.1e-39
FB|FBgn0033883 CG16935 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 534 (193.0 bits), Expect = 1.9e-51, P = 1.9e-51
 Identities = 106/201 (52%), Positives = 133/201 (66%)

Query:     1 MLKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGA 60
             MLKD+  L PGD VIQNGANSA GQ V Q+ R WG+ ++ IVR+R +I +LK  L+ LGA
Sbjct:   154 MLKDFVQLCPGDTVIQNGANSAVGQAVHQLCRAWGINSVGIVRDRPEIAELKQMLQCLGA 213

Query:    61 DYVFTEEELR--NISRDASIPKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSREPVQ 118
               V TE E+R  +I +   + KP+LA NCVGG SAT + R L + GV+VTYGGMSREPV 
Sbjct:   214 TEVLTEAEIRTSDIFKSGKLKKPRLAFNCVGGKSATEVSRHLDNGGVLVTYGGMSREPVT 273

Query:   119 IPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTEMMRTGKLAAPAHKFVTLKNF 178
             + T   IFKDI  RG WMTRW KEN  S ER  M  E+ E+M  GK  AP H+ V L  F
Sbjct:   274 VATGPLIFKDIAFRGFWMTRWSKENYSSPERSKMFKEIFELMEQGKFVAPNHEMVPLAKF 333

Query:   179 QEALMNTMSIQGKSGVKYYID 199
             ++A    +S +G +G KY +D
Sbjct:   334 KDAAAAALSFKGFTGKKYILD 354




GO:0008270 "zinc ion binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0006631 "fatty acid metabolic process" evidence=ISS
GO:0019166 "trans-2-enoyl-CoA reductase (NADPH) activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISS
GO:0005875 "microtubule associated complex" evidence=IDA
RGD|3208 Mecr "mitochondrial trans-2-enoyl-CoA reductase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Z311 Mecr "Trans-2-enoyl-CoA reductase, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BV79 MECR "Trans-2-enoyl-CoA reductase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1349441 Mecr "mitochondrial trans-2-enoyl-CoA reductase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-399 mecr "mitochondrial trans-2-enoyl-CoA reductase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R1T2 MECR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q28GQ2 mecr "Trans-2-enoyl-CoA reductase, mitochondrial" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
WB|WBGene00012375 mecr-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q7YS70 MECR "Trans-2-enoyl-CoA reductase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9Z311MECR_RAT1, ., 3, ., 1, ., 3, 80.52870.90590.4906yesN/A
O45903MECR1_CAEEL1, ., 3, ., 1, ., 3, 80.53330.80690.4738yesN/A
Q9V6U9MECR_DROME1, ., 3, ., 1, ., 3, 80.52730.98510.5574yesN/A
Q9DCS3MECR_MOUSE1, ., 3, ., 1, ., 3, 80.52350.90590.4906yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
cd08290341 cd08290, ETR, 2-enoyl thioester reductase (ETR) 5e-94
cd05282323 cd05282, ETR_like, 2-enoyl thioester reductase-lik 9e-56
cd08292324 cd08292, ETR_like_2, 2-enoyl thioester reductase ( 2e-32
COG0604326 COG0604, Qor, NADPH:quinone reductase and related 1e-25
cd08268328 cd08268, MDR2, Medium chain dehydrogenases/reducta 6e-18
cd05188271 cd05188, MDR, Medium chain reductase/dehydrogenase 2e-17
cd08291324 cd08291, ETR_like_1, 2-enoyl thioester reductase ( 5e-17
cd08241323 cd08241, QOR1, Quinone oxidoreductase (QOR) 9e-15
cd08249339 cd08249, enoyl_reductase_like, enoyl_reductase_lik 2e-13
cd05289309 cd05289, MDR_like_2, alcohol dehydrogenase and qui 2e-12
pfam00107131 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase 4e-12
cd08266342 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t 5e-12
COG1064339 COG1064, AdhP, Zn-dependent alcohol dehydrogenases 6e-12
cd08267319 cd08267, MDR1, Medium chain dehydrogenases/reducta 1e-11
cd08264325 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of t 9e-11
cd08259332 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD 2e-10
cd08294329 cd08294, leukotriene_B4_DH_like, 13-PGR is a bifun 5e-10
PRK13771334 PRK13771, PRK13771, putative alcohol dehydrogenase 1e-09
COG1063350 COG1063, Tdh, Threonine dehydrogenase and related 4e-09
cd08254338 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e 1e-08
cd05288329 cd05288, PGDH, Prostaglandin dehydrogenases 2e-08
cd08253325 cd08253, zeta_crystallin, Zeta-crystallin with NAD 7e-08
TIGR02825325 TIGR02825, B4_12hDH, leukotriene B4 12-hydroxydehy 7e-08
pfam13602129 pfam13602, ADH_zinc_N_2, Zinc-binding dehydrogenas 5e-07
cd08271325 cd08271, MDR5, Medium chain dehydrogenases/reducta 3e-06
cd05276323 cd05276, p53_inducible_oxidoreductase, PIG3 p53-in 7e-06
cd08274350 cd08274, MDR9, Medium chain dehydrogenases/reducta 2e-05
cd05285343 cd05285, sorbitol_DH, Sorbitol dehydrogenase 2e-05
cd08297341 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CA 2e-05
cd08261337 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD 1e-04
cd05280325 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putativ 1e-04
cd08289326 cd08289, MDR_yhfp_like, Yhfp putative quinone oxid 2e-04
cd05286320 cd05286, QOR2, Quinone oxidoreductase (QOR) 3e-04
PTZ00354334 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisi 4e-04
cd08244324 cd08244, MDR_enoyl_red, Possible enoyl reductase 5e-04
COG2130340 COG2130, COG2130, Putative NADP-dependent oxidored 0.001
cd08270305 cd08270, MDR4, Medium chain dehydrogenases/reducta 0.002
cd08263367 cd08263, Zn_ADH10, Alcohol dehydrogenases of the M 0.002
cd08273331 cd08273, MDR8, Medium chain dehydrogenases/reducta 0.002
cd08240350 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexa 0.003
cd08298329 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CA 0.004
>gnl|CDD|176250 cd08290, ETR, 2-enoyl thioester reductase (ETR) Back     alignment and domain information
 Score =  277 bits (711), Expect = 5e-94
 Identities = 109/208 (52%), Positives = 140/208 (67%), Gaps = 11/208 (5%)

Query: 1   MLKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGA 60
           +L+D+  L PGD VIQNGANSA GQ VIQ+A+  G+KTIN+VR+R D+++LK  LK+LGA
Sbjct: 137 LLEDFVKLQPGDWVIQNGANSAVGQAVIQLAKLLGIKTINVVRDRPDLEELKERLKALGA 196

Query: 61  DYVFTEEEL-----RNISRDASIPKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSRE 115
           D+V TEEEL       + + A   +PKLALNCVGG SAT L R L   G MVTYGGMS +
Sbjct: 197 DHVLTEEELRSLLATELLKSAPGGRPKLALNCVGGKSATELARLLSPGGTMVTYGGMSGQ 256

Query: 116 PVQIPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTEMMRTGKLAAPAHKFVT- 174
           PV +PTS  IFKDITLRG W+TRW  +     E++ M+ EL E++R GKL AP  + VT 
Sbjct: 257 PVTVPTSLLIFKDITLRGFWLTRW-LKRANPEEKEDMLEELAELIREGKLKAPPVEKVTD 315

Query: 175 --LKNFQEALMNTMSIQGKSGVKYYIDF 200
             L+ F++AL N +   G  G K  +  
Sbjct: 316 DPLEEFKDALANALK-GGGGG-KQVLVM 341


2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains, at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Candida tropicalis enoyl thioester reductase (Etr1p) catalyzes the NADPH-dependent reduction of trans-2-enoyl thioesters in mitochondrial fatty acid synthesis. Etr1p forms homodimers, with each subunit containing a nucleotide-binding Rossmann fold domain and a catalytic domain. Length = 341

>gnl|CDD|176645 cd05282, ETR_like, 2-enoyl thioester reductase-like Back     alignment and domain information
>gnl|CDD|176252 cd08292, ETR_like_2, 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176251 cd08291, ETR_like_1, 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like Back     alignment and domain information
>gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>gnl|CDD|215721 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase Back     alignment and domain information
>gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176254 cd08294, leukotriene_B4_DH_like, 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>gnl|CDD|176190 cd05288, PGDH, Prostaglandin dehydrogenases Back     alignment and domain information
>gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>gnl|CDD|131872 TIGR02825, B4_12hDH, leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>gnl|CDD|222256 pfam13602, ADH_zinc_N_2, Zinc-binding dehydrogenase Back     alignment and domain information
>gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>gnl|CDD|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase Back     alignment and domain information
>gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176183 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|176249 cd08289, MDR_yhfp_like, Yhfp putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|173547 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176206 cd08244, MDR_enoyl_red, Possible enoyl reductase Back     alignment and domain information
>gnl|CDD|225041 COG2130, COG2130, Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>gnl|CDD|176231 cd08270, MDR4, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176234 cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176202 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>gnl|CDD|176258 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 202
KOG1197|consensus336 99.97
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 99.97
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 99.96
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 99.96
COG2130340 Putative NADP-dependent oxidoreductases [General f 99.96
KOG0025|consensus354 99.95
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 99.95
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 99.94
KOG1198|consensus347 99.94
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 99.94
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 99.94
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 99.93
PRK09880343 L-idonate 5-dehydrogenase; Provisional 99.93
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 99.93
KOG0024|consensus354 99.93
PLN02827378 Alcohol dehydrogenase-like 99.93
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 99.93
PLN02586360 probable cinnamyl alcohol dehydrogenase 99.93
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 99.93
PLN02178375 cinnamyl-alcohol dehydrogenase 99.92
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 99.92
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 99.92
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 99.92
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 99.92
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 99.92
KOG1202|consensus 2376 99.92
PLN02740381 Alcohol dehydrogenase-like 99.91
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 99.91
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 99.91
PLN02514357 cinnamyl-alcohol dehydrogenase 99.91
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 99.91
KOG0023|consensus360 99.91
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 99.91
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 99.91
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 99.9
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 99.9
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 99.9
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 99.9
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 99.9
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 99.89
KOG1196|consensus343 99.89
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 99.89
KOG0022|consensus375 99.89
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 99.89
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 99.89
PTZ00354334 alcohol dehydrogenase; Provisional 99.89
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 99.89
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 99.88
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 99.88
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 99.88
TIGR02823323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 99.87
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 99.87
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 99.87
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 99.87
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 99.87
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 99.87
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 99.86
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 99.86
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 99.86
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 99.86
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 99.86
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 99.86
TIGR02817336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 99.85
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 99.85
PRK13771334 putative alcohol dehydrogenase; Provisional 99.85
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 99.85
cd08251303 polyketide_synthase polyketide synthase. Polyketid 99.85
cd08288324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 99.85
PRK10083339 putative oxidoreductase; Provisional 99.84
cd08276336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 99.84
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 99.84
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 99.84
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 99.84
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 99.84
cd05195293 enoyl_red enoyl reductase of polyketide synthase. 99.84
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 99.84
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 99.84
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 99.84
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 99.84
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 99.84
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 99.83
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 99.83
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 99.83
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 99.83
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 99.83
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 99.83
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 99.83
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 99.83
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 99.83
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 99.83
cd08262341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 99.83
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 99.83
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 99.83
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 99.82
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 99.82
cd08272326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 99.82
cd08252336 AL_MDR Arginate lyase and other MDR family members 99.82
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 99.82
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 99.82
cd08279363 Zn_ADH_class_III Class III alcohol dehydrogenase. 99.82
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 99.82
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 99.82
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 99.81
cd08235343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 99.81
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 99.81
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 99.81
PLN02702364 L-idonate 5-dehydrogenase 99.81
cd08264325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 99.81
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 99.81
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 99.8
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 99.8
cd08282375 PFDH_like Pseudomonas putida aldehyde-dismutating 99.79
cd08236343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 99.79
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 99.79
cd08271325 MDR5 Medium chain dehydrogenases/reductase (MDR)/z 99.79
cd08273331 MDR8 Medium chain dehydrogenases/reductase (MDR)/z 99.78
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 99.78
cd05281341 TDH Threonine dehydrogenase. L-threonine dehydroge 99.78
cd08275337 MDR3 Medium chain dehydrogenases/reductase (MDR)/z 99.76
cd08247352 AST1_like AST1 is a cytoplasmic protein associated 99.76
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 99.76
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 99.76
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 99.75
cd05289309 MDR_like_2 alcohol dehydrogenase and quinone reduc 99.74
cd08267319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 99.72
cd08258306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 99.69
PF13602127 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQ 99.69
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 99.6
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 99.6
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 99.59
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 99.0
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 98.74
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.67
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.67
KOG1205|consensus282 98.55
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 98.54
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.52
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 98.51
PLN02494477 adenosylhomocysteinase 98.43
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 98.39
PRK12742237 oxidoreductase; Provisional 98.37
PRK07109 334 short chain dehydrogenase; Provisional 98.35
PRK06139 330 short chain dehydrogenase; Provisional 98.33
PRK08339263 short chain dehydrogenase; Provisional 98.32
COG0300265 DltE Short-chain dehydrogenases of various substra 98.32
PRK05993277 short chain dehydrogenase; Provisional 98.28
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.25
PRK06182273 short chain dehydrogenase; Validated 98.23
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 98.21
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 98.19
PRK12939250 short chain dehydrogenase; Provisional 98.18
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 98.17
PLN03209 576 translocon at the inner envelope of chloroplast su 98.16
PRK06198260 short chain dehydrogenase; Provisional 98.16
PRK05693274 short chain dehydrogenase; Provisional 98.14
PRK07904253 short chain dehydrogenase; Provisional 98.13
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 98.13
KOG1201|consensus300 98.13
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 98.12
PRK08324681 short chain dehydrogenase; Validated 98.11
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 98.09
PTZ00075476 Adenosylhomocysteinase; Provisional 98.09
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.08
PRK07806248 short chain dehydrogenase; Provisional 98.08
PRK08862227 short chain dehydrogenase; Provisional 98.07
PRK05867253 short chain dehydrogenase; Provisional 98.06
PRK07478254 short chain dehydrogenase; Provisional 98.06
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 98.06
PRK08265261 short chain dehydrogenase; Provisional 98.06
PRK05866293 short chain dehydrogenase; Provisional 98.06
PRK07832272 short chain dehydrogenase; Provisional 98.05
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 98.04
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.03
PRK12828239 short chain dehydrogenase; Provisional 98.02
PRK06128300 oxidoreductase; Provisional 98.02
PRK05872296 short chain dehydrogenase; Provisional 97.98
PRK07814263 short chain dehydrogenase; Provisional 97.98
PRK07831262 short chain dehydrogenase; Provisional 97.97
PRK05876275 short chain dehydrogenase; Provisional 97.97
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 97.96
PRK06949258 short chain dehydrogenase; Provisional 97.94
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 97.94
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 97.93
PRK12747252 short chain dehydrogenase; Provisional 97.93
PRK07523255 gluconate 5-dehydrogenase; Provisional 97.92
PRK07791286 short chain dehydrogenase; Provisional 97.92
PRK06172253 short chain dehydrogenase; Provisional 97.92
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 97.92
PRK07576264 short chain dehydrogenase; Provisional 97.92
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.91
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 97.91
PRK08589272 short chain dehydrogenase; Validated 97.91
PRK09291257 short chain dehydrogenase; Provisional 97.9
PRK07062265 short chain dehydrogenase; Provisional 97.9
PRK06181263 short chain dehydrogenase; Provisional 97.9
PRK07677252 short chain dehydrogenase; Provisional 97.9
PRK06194287 hypothetical protein; Provisional 97.9
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 97.9
PRK07890258 short chain dehydrogenase; Provisional 97.89
PRK08340259 glucose-1-dehydrogenase; Provisional 97.89
PRK06483236 dihydromonapterin reductase; Provisional 97.89
PRK08303305 short chain dehydrogenase; Provisional 97.88
PRK08085254 gluconate 5-dehydrogenase; Provisional 97.88
PRK06484520 short chain dehydrogenase; Validated 97.88
PRK05854313 short chain dehydrogenase; Provisional 97.87
PRK06125259 short chain dehydrogenase; Provisional 97.87
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.87
PRK08213259 gluconate 5-dehydrogenase; Provisional 97.87
PRK07060245 short chain dehydrogenase; Provisional 97.85
PRK07063260 short chain dehydrogenase; Provisional 97.85
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 97.85
PRK07825273 short chain dehydrogenase; Provisional 97.85
PRK09072263 short chain dehydrogenase; Provisional 97.85
PRK12938246 acetyacetyl-CoA reductase; Provisional 97.85
PRK06701290 short chain dehydrogenase; Provisional 97.85
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.85
PLN02780320 ketoreductase/ oxidoreductase 97.84
PRK07097265 gluconate 5-dehydrogenase; Provisional 97.84
PRK06914280 short chain dehydrogenase; Provisional 97.84
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 97.84
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.84
PRK08643256 acetoin reductase; Validated 97.83
PRK07035252 short chain dehydrogenase; Provisional 97.83
PRK06057255 short chain dehydrogenase; Provisional 97.83
KOG0725|consensus270 97.82
PRK06940275 short chain dehydrogenase; Provisional 97.82
CHL00194 317 ycf39 Ycf39; Provisional 97.82
KOG4169|consensus261 97.82
PRK08277278 D-mannonate oxidoreductase; Provisional 97.81
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 97.81
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 97.81
PRK07985294 oxidoreductase; Provisional 97.81
PRK08628258 short chain dehydrogenase; Provisional 97.81
PRK07454241 short chain dehydrogenase; Provisional 97.8
PRK08017256 oxidoreductase; Provisional 97.8
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 97.78
PRK12937245 short chain dehydrogenase; Provisional 97.78
PRK06720169 hypothetical protein; Provisional 97.78
PRK07453 322 protochlorophyllide oxidoreductase; Validated 97.78
PRK06124256 gluconate 5-dehydrogenase; Provisional 97.77
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 97.77
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 97.77
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.76
PRK06500249 short chain dehydrogenase; Provisional 97.75
PRK06138252 short chain dehydrogenase; Provisional 97.75
PRK08177225 short chain dehydrogenase; Provisional 97.75
PRK07774250 short chain dehydrogenase; Provisional 97.75
PRK10538248 malonic semialdehyde reductase; Provisional 97.75
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.75
PRK06196315 oxidoreductase; Provisional 97.74
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 97.74
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 97.74
COG2910211 Putative NADH-flavin reductase [General function p 97.73
PRK09242257 tropinone reductase; Provisional 97.73
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 97.73
PRK07326237 short chain dehydrogenase; Provisional 97.73
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.73
PRK06114254 short chain dehydrogenase; Provisional 97.73
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 97.72
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.72
PRK05650270 short chain dehydrogenase; Provisional 97.72
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 97.71
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 97.69
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 97.69
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 97.69
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 97.68
PRK12829264 short chain dehydrogenase; Provisional 97.68
PRK08278273 short chain dehydrogenase; Provisional 97.68
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 97.68
PRK06197306 short chain dehydrogenase; Provisional 97.67
PRK08703239 short chain dehydrogenase; Provisional 97.67
PRK12743256 oxidoreductase; Provisional 97.66
PRK06180277 short chain dehydrogenase; Provisional 97.66
PRK05599246 hypothetical protein; Provisional 97.66
PRK08267260 short chain dehydrogenase; Provisional 97.66
PRK07024257 short chain dehydrogenase; Provisional 97.66
PRK09186256 flagellin modification protein A; Provisional 97.66
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 97.66
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 97.65
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.65
PRK05875276 short chain dehydrogenase; Provisional 97.64
PRK07775274 short chain dehydrogenase; Provisional 97.63
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 97.63
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 97.63
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 97.63
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.62
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.62
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 97.62
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 97.61
PRK06841255 short chain dehydrogenase; Provisional 97.6
PRK05717255 oxidoreductase; Validated 97.6
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 97.59
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 97.57
KOG1502|consensus 327 97.57
KOG1200|consensus256 97.56
PRK07102243 short chain dehydrogenase; Provisional 97.56
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 97.56
PRK06484 520 short chain dehydrogenase; Validated 97.56
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 97.56
KOG1207|consensus245 97.55
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 97.55
PRK12367245 short chain dehydrogenase; Provisional 97.55
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 97.55
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 97.55
PRK12935247 acetoacetyl-CoA reductase; Provisional 97.53
PLN02253280 xanthoxin dehydrogenase 97.53
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 97.52
PRK07074257 short chain dehydrogenase; Provisional 97.52
TIGR02415254 23BDH acetoin reductases. One member of this famil 97.51
PRK06953222 short chain dehydrogenase; Provisional 97.51
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.51
PRK08936261 glucose-1-dehydrogenase; Provisional 97.5
PRK05855582 short chain dehydrogenase; Validated 97.5
PRK07201657 short chain dehydrogenase; Provisional 97.5
PRK08226263 short chain dehydrogenase; Provisional 97.5
PRK08251248 short chain dehydrogenase; Provisional 97.49
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 97.49
PRK05884223 short chain dehydrogenase; Provisional 97.49
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 97.48
PF11017314 DUF2855: Protein of unknown function (DUF2855); In 97.47
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 97.47
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.47
PRK07424406 bifunctional sterol desaturase/short chain dehydro 97.46
KOG1610|consensus322 97.46
PRK12746254 short chain dehydrogenase; Provisional 97.45
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.44
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 97.44
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 97.43
PRK12744257 short chain dehydrogenase; Provisional 97.43
PRK07067257 sorbitol dehydrogenase; Provisional 97.43
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 97.42
PRK06179270 short chain dehydrogenase; Provisional 97.42
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.42
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 97.42
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 97.41
PRK06398258 aldose dehydrogenase; Validated 97.41
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.4
PRK06123248 short chain dehydrogenase; Provisional 97.39
PRK07577234 short chain dehydrogenase; Provisional 97.39
PRK08264238 short chain dehydrogenase; Validated 97.39
PRK09134258 short chain dehydrogenase; Provisional 97.38
KOG1208|consensus314 97.37
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.37
PRK06947248 glucose-1-dehydrogenase; Provisional 97.36
PRK09135249 pteridine reductase; Provisional 97.35
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.35
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.35
PRK13940414 glutamyl-tRNA reductase; Provisional 97.35
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 97.33
KOG1014|consensus312 97.33
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 97.32
PRK05447 385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 97.31
KOG1199|consensus260 97.3
PRK12827249 short chain dehydrogenase; Provisional 97.3
PRK08263275 short chain dehydrogenase; Provisional 97.3
PRK07856252 short chain dehydrogenase; Provisional 97.29
PRK06482276 short chain dehydrogenase; Provisional 97.28
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 97.28
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 97.27
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 97.27
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 97.26
PRK06719157 precorrin-2 dehydrogenase; Validated 97.26
KOG1209|consensus289 97.26
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.25
COG3288356 PntA NAD/NADP transhydrogenase alpha subunit [Ener 97.25
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.24
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 97.22
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.22
PRK06523260 short chain dehydrogenase; Provisional 97.21
PRK06101240 short chain dehydrogenase; Provisional 97.2
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.19
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.16
PRK12548289 shikimate 5-dehydrogenase; Provisional 97.15
KOG1210|consensus331 97.14
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 97.13
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.12
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 97.12
PRK05562223 precorrin-2 dehydrogenase; Provisional 97.11
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.1
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.06
PLN02240 352 UDP-glucose 4-epimerase 97.06
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 97.06
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 97.05
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 97.03
PRK07069251 short chain dehydrogenase; Validated 97.02
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 97.01
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 97.01
PLN00016 378 RNA-binding protein; Provisional 97.01
PRK11207197 tellurite resistance protein TehB; Provisional 97.0
PLN02896 353 cinnamyl-alcohol dehydrogenase 96.98
PRK04148134 hypothetical protein; Provisional 96.96
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 96.95
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 96.94
COG4122219 Predicted O-methyltransferase [General function pr 96.94
PLN00015 308 protochlorophyllide reductase 96.94
COG0623259 FabI Enoyl-[acyl-carrier-protein] 96.94
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 96.93
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 96.93
PRK10675 338 UDP-galactose-4-epimerase; Provisional 96.92
TIGR00438188 rrmJ cell division protein FtsJ. 96.92
PRK08618325 ornithine cyclodeaminase; Validated 96.92
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 96.91
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 96.91
PRK08309177 short chain dehydrogenase; Provisional 96.91
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 96.9
PRK07041230 short chain dehydrogenase; Provisional 96.89
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.88
PRK07023243 short chain dehydrogenase; Provisional 96.87
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 96.86
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 96.86
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 96.86
PLN02214 342 cinnamoyl-CoA reductase 96.85
PRK08219227 short chain dehydrogenase; Provisional 96.84
PRK12824245 acetoacetyl-CoA reductase; Provisional 96.84
PRK14967223 putative methyltransferase; Provisional 96.84
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 96.83
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 96.82
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 96.81
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 96.79
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 96.75
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 96.75
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 96.75
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 96.74
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 96.74
PRK07574385 formate dehydrogenase; Provisional 96.74
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 96.74
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 96.72
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 96.72
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 96.71
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 96.7
PLN02244340 tocopherol O-methyltransferase 96.7
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.7
PLN02653 340 GDP-mannose 4,6-dehydratase 96.69
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 96.68
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 96.67
PLN02928347 oxidoreductase family protein 96.67
PLN02476278 O-methyltransferase 96.66
PLN03139386 formate dehydrogenase; Provisional 96.66
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 96.66
PLN02686 367 cinnamoyl-CoA reductase 96.66
KOG1203|consensus 411 96.64
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.64
PLN02427 386 UDP-apiose/xylose synthase 96.62
PLN02696 454 1-deoxy-D-xylulose-5-phosphate reductoisomerase 96.62
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.6
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.6
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 96.6
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 96.6
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 96.58
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 96.58
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.57
PRK08300 302 acetaldehyde dehydrogenase; Validated 96.57
COG1028251 FabG Dehydrogenases with different specificities ( 96.56
PRK13243333 glyoxylate reductase; Reviewed 96.55
PRK07402196 precorrin-6B methylase; Provisional 96.55
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 96.55
PRK14982340 acyl-ACP reductase; Provisional 96.55
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 96.54
PLN02695 370 GDP-D-mannose-3',5'-epimerase 96.53
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 96.53
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 96.53
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 96.52
PRK07578199 short chain dehydrogenase; Provisional 96.52
PLN02650 351 dihydroflavonol-4-reductase 96.51
PRK06924251 short chain dehydrogenase; Provisional 96.51
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 96.51
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 96.51
PRK08655 437 prephenate dehydrogenase; Provisional 96.5
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 96.5
COG0031300 CysK Cysteine synthase [Amino acid transport and m 96.49
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 96.48
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 96.48
PRK06849 389 hypothetical protein; Provisional 96.48
PLN00198 338 anthocyanidin reductase; Provisional 96.46
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.46
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 96.45
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.45
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 96.44
PRK11150 308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 96.43
PLN02589247 caffeoyl-CoA O-methyltransferase 96.41
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 96.41
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.41
TIGR00243 389 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 96.39
KOG1252|consensus362 96.39
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 96.38
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.38
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 96.36
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 96.35
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 96.33
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 96.31
PRK14968188 putative methyltransferase; Provisional 96.3
PLN02256304 arogenate dehydrogenase 96.29
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.26
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 96.26
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 96.26
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.25
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 96.24
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 96.23
PRK09620229 hypothetical protein; Provisional 96.23
PRK07340304 ornithine cyclodeaminase; Validated 96.23
>KOG1197|consensus Back     alignment and domain information
Probab=99.97  E-value=1.7e-30  Score=184.87  Aligned_cols=192  Identities=19%  Similarity=0.211  Sum_probs=166.7

Q ss_pred             cccccCCCCCCEEEEeCCCcHHHHHHHHHHHHCCCcEEEEecCcccHHHHHHHHHhcCCceEeCh--hHHHh-HHHhhCC
Q psy2961           2 LKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGADYVFTE--EELRN-ISRDASI   78 (202)
Q Consensus         2 l~~~~~~~~g~~VlI~g~~~~vG~~~i~la~~~g~~vi~~~~~~~~~~~~~~~~~~lg~~~v~~~--~~~~~-~~~~~~~   78 (202)
                      |++..++++|++||++.+.|++|++++|+++..|+++|+++++.+    +++.+++.|+++.+++  +|+.+ +.+.+++
T Consensus       138 l~e~y~vkpGhtVlvhaAAGGVGlll~Ql~ra~~a~tI~~asTae----K~~~akenG~~h~I~y~~eD~v~~V~kiTng  213 (336)
T KOG1197|consen  138 LFEAYNVKPGHTVLVHAAAGGVGLLLCQLLRAVGAHTIATASTAE----KHEIAKENGAEHPIDYSTEDYVDEVKKITNG  213 (336)
T ss_pred             HHHhcCCCCCCEEEEEeccccHHHHHHHHHHhcCcEEEEEeccHH----HHHHHHhcCCcceeeccchhHHHHHHhccCC
Confidence            456778999999999999999999999999999999999999987    7999999999999974  78888 9999999


Q ss_pred             CCCeEEEecCCCchHHHHHHhcccCcEEEEEeccCCCCcCCCcccccccCeeEEEEechhHhhhcccHHHHHHHHHHHHH
Q psy2961          79 PKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSREPVQIPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTE  158 (202)
Q Consensus        79 ~~~d~vid~~g~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~  158 (202)
                      .|+|+++|++|.+.+...+.+|++.|.+|.+|...+...+++...+.-+++.+..-.+..|   ...+........++..
T Consensus       214 KGVd~vyDsvG~dt~~~sl~~Lk~~G~mVSfG~asgl~~p~~l~~ls~k~l~lvrpsl~gY---i~g~~el~~~v~rl~a  290 (336)
T KOG1197|consen  214 KGVDAVYDSVGKDTFAKSLAALKPMGKMVSFGNASGLIDPIPLNQLSPKALQLVRPSLLGY---IDGEVELVSYVARLFA  290 (336)
T ss_pred             CCceeeeccccchhhHHHHHHhccCceEEEeccccCCCCCeehhhcChhhhhhccHhhhcc---cCCHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999988877667777666666665544332222   2333666778889999


Q ss_pred             HHHcCCCCCCcceeechhhHHHHHHHHhhhcCCCCceEEEeecC
Q psy2961         159 MMRTGKLAAPAHKFVTLKNFQEALMNTMSIQGKSGVKYYIDFRQ  202 (202)
Q Consensus       159 ~~~~g~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~gkvv~~~~~  202 (202)
                      ++-+|.+++.+.++||++++.+|+..++  ++.+.||+++...|
T Consensus       291 lvnsg~lk~~I~~~ypls~vadA~~die--srktvGkvlLlp~~  332 (336)
T KOG1197|consen  291 LVNSGHLKIHIDHVYPLSKVADAHADIE--SRKTVGKVLLLPGP  332 (336)
T ss_pred             HhhcCccceeeeeecchHHHHHHHHHHH--hhhccceEEEeCCc
Confidence            9999999999999999999999999999  89999999997753



>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>KOG0025|consensus Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>KOG1198|consensus Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG1196|consensus Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>KOG0022|consensus Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PF13602 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQH_A 2VN8_A 3GOH_A 4A27_A Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF11017 DUF2855: Protein of unknown function (DUF2855); InterPro: IPR021276 This family of proteins has no known function Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG3288 PntA NAD/NADP transhydrogenase alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG1203|consensus Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR00243 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase Back     alignment and domain information
>KOG1252|consensus Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
2vcy_A344 Crystal Structure Of 2-Enoyl Thioester Reductase Of 2e-50
1zsy_A357 The Structure Of Human Mitochondrial 2-Enoyl Thioes 3e-50
1n9g_B386 Mitochondrial 2-enoyl Thioester Reductase Etr1p/etr 7e-30
1gu7_A364 Enoyl Thioester Reductase From Candida Tropicalis L 8e-30
1gyr_A364 Mutant Form Of Enoyl Thioester Reductase From Candi 8e-30
1h0k_A364 Enoyl Thioester Reductase 2 Length = 364 1e-29
1n9g_A386 Mitochondrial 2-enoyl Thioester Reductase Etr1p/etr 1e-29
1v3t_A333 Crystal Structure Of Leukotriene B4 12- Hydroxydehy 6e-07
3pi7_A349 Crystal Structure Of A Putative Nadph:quinone Reduc 6e-06
2y05_A328 Crystal Structure Of Human Leukotriene B4 12-Hydrox 4e-05
1zsv_A349 Crystal Structure Of Human Nadp-Dependent Leukotrie 4e-05
>pdb|2VCY|A Chain A, Crystal Structure Of 2-Enoyl Thioester Reductase Of Human Fas Ii Length = 344 Back     alignment and structure

Iteration: 1

Score = 194 bits (494), Expect = 2e-50, Method: Compositional matrix adjust. Identities = 98/191 (51%), Positives = 131/191 (68%), Gaps = 8/191 (4%) Query: 1 MLKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGA 60 ML D+ L PGD VIQN +NS GQ VIQIA GL+TIN+VR+R DI KL LKSLGA Sbjct: 145 MLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGA 204 Query: 61 DYVFTEEELR-----NISRDASIPKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSRE 115 ++V TEEELR N +D +P+P+LALNCVGG S+T LLR L G MVTYGGM+++ Sbjct: 205 EHVITEEELRRPEMKNFFKD--MPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQ 262 Query: 116 PVQIPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTEMMRTGKLAAPAHKFVTL 175 PV S IFKD+ LRG W+++W+K++ + K ++ L +++R G+L APA V L Sbjct: 263 PVVASVSLLIFKDLKLRGFWLSQWKKDHSPD-QFKELILTLCDLIRRGQLTAPACSQVPL 321 Query: 176 KNFQEALMNTM 186 +++Q AL +M Sbjct: 322 QDYQSALEASM 332
>pdb|1ZSY|A Chain A, The Structure Of Human Mitochondrial 2-Enoyl Thioester Reductase (Cgi- 63) Length = 357 Back     alignment and structure
>pdb|1N9G|B Chain B, Mitochondrial 2-enoyl Thioester Reductase Etr1p/etr2p Heterodimer From Candida Tropicalis Length = 386 Back     alignment and structure
>pdb|1GU7|A Chain A, Enoyl Thioester Reductase From Candida Tropicalis Length = 364 Back     alignment and structure
>pdb|1GYR|A Chain A, Mutant Form Of Enoyl Thioester Reductase From Candida Tropicalis Length = 364 Back     alignment and structure
>pdb|1H0K|A Chain A, Enoyl Thioester Reductase 2 Length = 364 Back     alignment and structure
>pdb|1N9G|A Chain A, Mitochondrial 2-enoyl Thioester Reductase Etr1p/etr2p Heterodimer From Candida Tropicalis Length = 386 Back     alignment and structure
>pdb|1V3T|A Chain A, Crystal Structure Of Leukotriene B4 12- Hydroxydehydrogenase15-Oxo-Prostaglandin 13-Reductase Length = 333 Back     alignment and structure
>pdb|3PI7|A Chain A, Crystal Structure Of A Putative Nadph:quinone Reductase (Mll3093) From Mesorhizobium Loti At 1.71 A Resolution Length = 349 Back     alignment and structure
>pdb|2Y05|A Chain A, Crystal Structure Of Human Leukotriene B4 12-Hydroxydehydrogenase In Complex With Nadp And Raloxifene Length = 328 Back     alignment and structure
>pdb|1ZSV|A Chain A, Crystal Structure Of Human Nadp-Dependent Leukotriene B4 12- Hydroxydehydrogenase Length = 349 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 8e-67
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 2e-64
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 1e-38
3gms_A340 Putative NADPH:quinone reductase; structural genom 5e-33
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 5e-20
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 3e-15
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 4e-13
4eye_A342 Probable oxidoreductase; structural genomics, niai 2e-12
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 1e-11
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 3e-11
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 5e-11
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 9e-11
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 1e-10
3krt_A456 Crotonyl COA reductase; structural genomics, prote 2e-10
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 3e-10
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 3e-10
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 9e-10
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 1e-09
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 4e-09
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 1e-08
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 2e-08
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 2e-08
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 2e-08
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 2e-08
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 3e-08
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 7e-08
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 8e-08
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 1e-07
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 1e-07
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 3e-07
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 3e-07
3fbg_A346 Putative arginate lyase; structural genomics, unkn 5e-07
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 7e-07
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 8e-07
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 2e-06
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 2e-06
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 3e-06
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 7e-06
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 8e-06
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 1e-05
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 1e-05
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 1e-05
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 3e-05
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 4e-05
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 6e-05
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 8e-05
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 4e-04
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 5e-04
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 8e-04
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 Back     alignment and structure
 Score =  207 bits (530), Expect = 8e-67
 Identities = 98/196 (50%), Positives = 129/196 (65%), Gaps = 6/196 (3%)

Query: 1   MLKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGA 60
           ML D+  L PGD VIQN +NS  GQ VIQIA   GL+TIN+VR+R DI KL   LKSLGA
Sbjct: 158 MLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGA 217

Query: 61  DYVFTEEELRNISRDASI---PKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSREPV 117
           ++V TEEELR           P+P+LALNCVGG S+T LLR L   G MVTYGGM+++PV
Sbjct: 218 EHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPV 277

Query: 118 QIPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTEMMRTGKLAAPAHKFVTLKN 177
               S  IFKD+ LRG W+++W+K++    + K ++  L +++R G+L APA   V L++
Sbjct: 278 VASVSLLIFKDLKLRGFWLSQWKKDHS-PDQFKELILTLCDLIRRGQLTAPACSQVPLQD 336

Query: 178 FQEALMNTMS--IQGK 191
           +Q AL  +M   I  K
Sbjct: 337 YQSALEASMKPFISSK 352


>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Length = 349 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Length = 379 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Length = 315 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Length = 321 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Length = 343 Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Length = 349 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Length = 334 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Length = 302 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Length = 346 Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Length = 353 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Length = 348 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Length = 325 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Length = 363 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Length = 333 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Length = 345 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Length = 404 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Length = 370 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 327 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Length = 354 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Length = 346 Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Length = 330 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Length = 375 Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Length = 328 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Length = 340 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Length = 356 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Length = 339 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Length = 198 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Length = 343 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Length = 333 Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Length = 324 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Length = 357 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Length = 347 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Length = 363 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Length = 345 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Length = 380 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query202
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 99.98
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 99.98
4eye_A342 Probable oxidoreductase; structural genomics, niai 99.97
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 99.97
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 99.97
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 99.97
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 99.97
3fbg_A346 Putative arginate lyase; structural genomics, unkn 99.97
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 99.97
3krt_A456 Crotonyl COA reductase; structural genomics, prote 99.96
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 99.96
3gms_A340 Putative NADPH:quinone reductase; structural genom 99.96
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 99.96
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 99.96
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 99.96
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 99.96
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 99.96
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 99.96
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 99.96
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 99.96
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 99.96
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 99.96
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 99.96
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 99.96
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 99.96
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 99.96
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 99.96
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 99.95
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 99.95
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 99.95
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 99.95
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 99.95
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 99.95
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 99.95
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 99.95
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 99.95
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 99.95
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 99.95
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 99.95
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 99.95
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 99.95
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 99.95
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 99.95
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 99.95
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 99.95
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 99.95
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 99.95
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 99.95
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 99.95
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 99.95
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 99.95
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 99.95
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 99.95
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 99.95
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 99.95
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 99.95
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 99.95
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 99.94
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 99.94
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 99.94
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 99.94
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 99.94
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 99.94
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 99.94
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 99.94
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 99.94
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 99.93
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.92
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 99.92
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 99.91
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 99.88
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 99.33
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 99.2
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 99.18
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 99.17
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 98.99
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 98.86
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 98.82
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 98.74
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 98.71
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 98.6
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 98.56
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.54
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 98.49
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 98.44
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 98.42
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.41
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 98.41
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 98.4
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.39
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 98.37
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 98.37
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 98.37
3edm_A259 Short chain dehydrogenase; structural genomics, ox 98.36
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 98.36
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 98.35
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 98.35
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 98.35
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 98.34
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 98.33
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.33
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 98.33
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 98.33
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 98.32
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 98.32
4eso_A255 Putative oxidoreductase; NADP, structural genomics 98.31
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 98.29
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 98.29
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 98.29
2rir_A300 Dipicolinate synthase, A chain; structural genomic 98.28
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.27
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 98.27
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 98.26
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 98.26
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 98.26
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 98.26
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 98.25
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 98.24
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 98.24
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 98.24
3imf_A257 Short chain dehydrogenase; structural genomics, in 98.24
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 98.24
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 98.24
3tjr_A301 Short chain dehydrogenase; structural genomics, se 98.23
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.23
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 98.22
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 98.22
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 98.22
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 98.22
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 98.21
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 98.21
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 98.21
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 98.2
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 98.2
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 98.2
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 98.19
3rih_A293 Short chain dehydrogenase or reductase; structural 98.19
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 98.19
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 98.19
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 98.19
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 98.19
3gem_A260 Short chain dehydrogenase; structural genomics, AP 98.18
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 98.18
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 98.17
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 98.17
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 98.17
3tox_A280 Short chain dehydrogenase; structural genomics, PS 98.16
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 98.16
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 98.15
3cxt_A291 Dehydrogenase with different specificities; rossma 98.15
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 98.15
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 98.15
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 98.15
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.14
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 98.14
3c85_A183 Putative glutathione-regulated potassium-efflux S 98.14
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 98.13
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 98.12
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 98.12
1xq1_A266 Putative tropinone reducatse; structural genomics, 98.12
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 98.12
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 98.11
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 98.11
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 98.11
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 98.11
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 98.1
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 98.1
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 98.1
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 98.1
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 98.1
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 98.1
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 98.1
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 98.1
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 98.1
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 98.1
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 98.1
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 98.09
3tsc_A277 Putative oxidoreductase; structural genomics, seat 98.09
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 98.09
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 98.09
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 98.09
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 98.09
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 98.09
3e03_A274 Short chain dehydrogenase; structural genomics, PS 98.08
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 98.08
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 98.08
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 98.08
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 98.08
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 98.07
1xkq_A280 Short-chain reductase family member (5D234); parra 98.07
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 98.07
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 98.07
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 98.07
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 98.07
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 98.06
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 98.06
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 98.06
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 98.06
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 98.06
1xhl_A297 Short-chain dehydrogenase/reductase family member 98.06
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 98.06
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 98.06
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 98.05
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 98.05
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 98.04
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 98.04
3qlj_A322 Short chain dehydrogenase; structural genomics, se 98.04
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 98.04
4dqx_A277 Probable oxidoreductase protein; structural genomi 98.03
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 98.03
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 98.03
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 98.03
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 98.03
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 98.03
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.03
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 98.03
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 98.02
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 98.02
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 98.02
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 98.02
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 98.02
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 98.02
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 98.01
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 98.01
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 98.01
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 98.01
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 98.01
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 98.0
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 98.0
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 98.0
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 98.0
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 98.0
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 97.99
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 97.99
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 97.99
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 97.99
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 97.99
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 97.99
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 97.98
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 97.98
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 97.98
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 97.98
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 97.98
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 97.98
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 97.97
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 97.97
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.96
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.96
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.95
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 97.94
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 97.93
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 97.92
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 97.92
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 97.92
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 97.91
1spx_A278 Short-chain reductase family member (5L265); paral 97.91
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.91
1ooe_A236 Dihydropteridine reductase; structural genomics, P 97.91
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 97.9
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 97.9
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 97.89
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 97.89
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 97.89
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 97.89
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 97.89
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 97.88
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 97.88
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 97.87
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 97.87
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 97.87
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 97.86
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 97.86
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 97.86
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 97.86
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 97.86
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 97.84
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 97.84
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 97.84
1nff_A260 Putative oxidoreductase RV2002; directed evolution 97.84
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 97.82
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 97.82
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 97.82
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 97.8
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 97.8
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 97.8
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 97.79
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 97.79
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 97.79
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 97.79
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 97.78
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 97.77
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 97.77
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 97.76
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 97.76
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 97.76
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 97.75
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 97.75
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 97.74
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 97.74
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 97.74
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 97.74
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 97.73
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 97.72
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 97.72
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 97.72
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 97.71
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 97.71
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 97.69
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 97.69
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.69
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 97.69
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 97.68
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 97.68
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 97.68
3slk_A795 Polyketide synthase extender module 2; rossmann fo 97.68
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.68
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 97.65
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 97.65
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 97.65
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 97.65
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 97.64
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 97.64
1xq6_A253 Unknown protein; structural genomics, protein stru 97.64
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.63
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 97.63
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 97.63
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 97.61
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 97.6
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 97.58
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 97.58
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 97.57
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 97.56
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 97.56
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 97.55
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 97.54
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 97.53
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 97.53
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 97.53
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 97.53
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 97.52
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 97.52
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 97.51
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 97.51
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 97.5
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 97.49
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 97.48
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 97.47
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 97.47
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 97.47
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 97.47
4ggo_A 401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 97.47
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 97.45
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 97.45
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 97.45
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 97.45
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 97.44
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 97.44
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 97.43
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 97.42
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 97.42
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 97.41
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.4
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 97.4
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 97.39
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 97.39
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 97.38
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 97.38
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.38
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 97.38
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 97.36
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 97.36
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 97.35
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 97.34
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 97.34
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 97.34
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.31
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 97.3
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 97.29
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 97.29
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 97.27
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 97.27
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 97.27
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 97.27
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 97.26
4e4y_A244 Short chain dehydrogenase family protein; structur 97.26
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 97.25
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 97.24
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 97.24
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 97.24
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 97.23
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 97.22
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 97.22
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 97.22
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 97.22
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 97.22
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.21
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 97.21
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 97.2
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.2
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 97.2
3p2o_A285 Bifunctional protein fold; structural genomics, ce 97.19
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 97.17
2avd_A229 Catechol-O-methyltransferase; structural genomics, 97.16
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.16
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.16
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 97.15
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 97.15
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 97.14
3l07_A285 Bifunctional protein fold; structural genomics, ID 97.14
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 97.14
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 97.12
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 97.11
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 97.11
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 97.11
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 97.1
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.09
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 97.08
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 97.08
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 97.07
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 97.07
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 97.06
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 97.06
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 97.06
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 97.05
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 97.04
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 97.04
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 97.04
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 97.04
3duw_A223 OMT, O-methyltransferase, putative; alternating of 97.03
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.03
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 97.02
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 97.02
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.01
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 97.01
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.0
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 97.0
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.99
3f4k_A257 Putative methyltransferase; structural genomics, P 96.98
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 96.98
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 96.97
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 96.97
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 96.96
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 96.95
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 96.93
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 96.92
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 96.92
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 96.92
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 96.92
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 96.92
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 96.89
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 96.89
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 96.88
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 96.87
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 96.85
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 96.85
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 96.84
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 96.84
3ius_A286 Uncharacterized conserved protein; APC63810, silic 96.83
4f6c_A 427 AUSA reductase domain protein; thioester reductase 96.83
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 96.83
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 96.82
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 96.81
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 96.81
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 96.8
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 96.8
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 96.8
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 96.79
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 96.77
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 96.75
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 96.74
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 96.74
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 96.74
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 96.73
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 96.73
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 96.73
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 96.72
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 96.72
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 96.72
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 96.72
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 96.71
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 96.71
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 96.71
1yb2_A275 Hypothetical protein TA0852; structural genomics, 96.71
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 96.7
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 96.7
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 96.69
2y1e_A 398 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o 96.69
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 96.68
2b25_A336 Hypothetical protein; structural genomics, methyl 96.68
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 96.68
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 96.67
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 96.67
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 96.67
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 96.66
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 96.66
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 96.65
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 96.65
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 96.65
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 96.65
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 96.64
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
Probab=99.98  E-value=4.9e-31  Score=203.13  Aligned_cols=192  Identities=20%  Similarity=0.257  Sum_probs=165.6

Q ss_pred             cccccCCCCCCEEEEeCCCcHHHHHHHHHHHHCCCcEEEEecCcccHHHHHHHHHhcCCceEeCh--hHHHh-HHHhhCC
Q psy2961           2 LKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGADYVFTE--EELRN-ISRDASI   78 (202)
Q Consensus         2 l~~~~~~~~g~~VlI~g~~~~vG~~~i~la~~~g~~vi~~~~~~~~~~~~~~~~~~lg~~~v~~~--~~~~~-~~~~~~~   78 (202)
                      +.+.+++++|++|||+|++|++|++++|+|+..|++|++++++++    +++.++++|++.++++  .++.+ +.+.+++
T Consensus       140 l~~~~~~~~g~~vlV~Ga~g~iG~~~~~~a~~~Ga~Vi~~~~~~~----~~~~~~~~ga~~~~~~~~~~~~~~~~~~~~~  215 (334)
T 3qwb_A          140 TNEAYHVKKGDYVLLFAAAGGVGLILNQLLKMKGAHTIAVASTDE----KLKIAKEYGAEYLINASKEDILRQVLKFTNG  215 (334)
T ss_dssp             HHTTSCCCTTCEEEESSTTBHHHHHHHHHHHHTTCEEEEEESSHH----HHHHHHHTTCSEEEETTTSCHHHHHHHHTTT
T ss_pred             HHHhccCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEeCCHH----HHHHHHHcCCcEEEeCCCchHHHHHHHHhCC
Confidence            345678999999999998889999999999999999999988765    6889999999999875  45666 8888877


Q ss_pred             CCCeEEEecCCCchHHHHHHhcccCcEEEEEeccCCCCcCCCcccccccCeeEEEEechhHhhhcccHHHHHHHHHHHHH
Q psy2961          79 PKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSREPVQIPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTE  158 (202)
Q Consensus        79 ~~~d~vid~~g~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~  158 (202)
                      .++|++|||+|++.+..++++++++|+++.+|...+....++...++.+++++.+++...+..   .+....+.++++.+
T Consensus       216 ~g~D~vid~~g~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~  292 (334)
T 3qwb_A          216 KGVDASFDSVGKDTFEISLAALKRKGVFVSFGNASGLIPPFSITRLSPKNITLVRPQLYGYIA---DPEEWKYYSDEFFG  292 (334)
T ss_dssp             SCEEEEEECCGGGGHHHHHHHEEEEEEEEECCCTTCCCCCBCGGGGTTTTCEEECCCGGGGSC---SHHHHHHHHHHHHH
T ss_pred             CCceEEEECCChHHHHHHHHHhccCCEEEEEcCCCCCCCCcchhhhhhCceEEEEEEeccccC---CHHHHHHHHHHHHH
Confidence            899999999999877789999999999999997665444667777888999999888766543   22556778899999


Q ss_pred             HHHcCCCCCCcceeechhhHHHHHHHHhhhcCCCCceEEEeecC
Q psy2961         159 MMRTGKLAAPAHKFVTLKNFQEALMNTMSIQGKSGVKYYIDFRQ  202 (202)
Q Consensus       159 ~~~~g~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~gkvv~~~~~  202 (202)
                      ++++|++++.++++|+++++++||+.+.  +++..||+|+++++
T Consensus       293 l~~~g~l~~~i~~~~~l~~~~~A~~~~~--~~~~~gKvvi~~~q  334 (334)
T 3qwb_A          293 LVNSKKLNIKIYKTYPLRDYRTAAADIE--SRKTVGKLVLEIPQ  334 (334)
T ss_dssp             HHHTTSSCCCEEEEEEGGGHHHHHHHHH--TTCCCBEEEEECCC
T ss_pred             HHHCCCccCceeeEEcHHHHHHHHHHHH--hCCCceEEEEecCC
Confidence            9999999999999999999999999999  88889999999864



>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2y1e_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase, DOXP/MEP pathway; 1.65A {Mycobacterium tuberculosis} PDB: 2jcv_A* 2jcz_A* 2jd2_A 2jd1_A 2y1d_A* 2y1c_A 2y1f_A* 2y1g_A* 3ras_A* 4a03_A* 4aic_A* 2jcx_A* 2jcy_A 2jd0_A* 2c82_A Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 202
d1gu7a2189 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yea 1e-24
d1v3va2182 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehyd 4e-10
d1vj1a2187 c.2.1.1 (A:125-311) Putative zinc-binding alcohol 2e-08
d1tt7a2167 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bac 4e-08
d1yb5a2174 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human 2e-07
d1o89a2177 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Esc 4e-06
d1vj0a2182 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {T 6e-04
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 189 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Alcohol dehydrogenase-like, C-terminal domain
domain: 2,4-dienoyl-CoA reductase
species: Yeast (Candida tropicalis) [TaxId: 5482]
 Score = 93.5 bits (231), Expect = 1e-24
 Identities = 71/173 (41%), Positives = 101/173 (58%), Gaps = 11/173 (6%)

Query: 1   MLKDYNSLSPG-DVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLG 59
           ML  Y  L+PG D  IQNG  SA G+   QI +     +I+++R+R ++D++ + LK LG
Sbjct: 19  MLTHYVKLTPGKDWFIQNGGTSAVGKYASQIGKLLNFNSISVIRDRPNLDEVVASLKELG 78

Query: 60  ADYVFTEEELRNISRD--------ASIPKPKLALNCVGGNSATNLLRTLVSKGVMVTYGG 111
           A  V TE++  +             S  + KLALNCVGG S+T + R L + G+M+TYGG
Sbjct: 79  ATQVITEDQNNSREFGPTIKEWIKQSGGEAKLALNCVGGKSSTGIARKLNNNGLMLTYGG 138

Query: 112 MSREPVQIPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTEMMRTGK 164
           MS +PV IPTS +IFK+ T  G W+T   K NKE   + S +N++      GK
Sbjct: 139 MSFQPVTIPTSLYIFKNFTSAGFWVTELLKNNKE--LKTSTLNQIIAWYEEGK 189


>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Length = 182 Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 187 Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Length = 167 Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Length = 177 Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 182 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query202
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 99.96
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.96
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.96
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 99.96
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.95
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.95
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.94
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.94
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.93
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 99.92
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.92
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 99.92
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.92
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.91
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 99.91
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.91
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 99.91
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.91
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 99.91
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.9
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.9
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.9
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.88
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.88
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.88
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 99.88
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.87
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.87
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 99.41
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 98.6
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 98.58
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 98.58
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 98.58
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 98.55
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 98.55
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 98.54
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 98.54
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 98.53
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.53
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 98.52
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 98.51
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 98.49
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 98.48
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 98.48
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 98.48
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 98.47
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 98.46
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 98.45
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.42
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 98.38
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 98.38
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 98.37
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 98.36
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 98.36
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 98.35
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 98.35
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 98.34
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 98.33
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 98.33
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 98.33
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 98.32
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 98.31
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 98.3
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 98.3
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 98.28
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 98.28
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 98.28
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 98.27
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 98.27
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 98.27
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 98.27
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 98.26
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 98.25
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 98.25
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 98.24
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 98.24
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 98.22
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 98.21
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 98.19
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 98.18
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 98.17
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 98.13
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 98.11
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.1
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 98.1
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 98.08
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 98.07
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.04
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 98.03
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 98.03
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.97
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 97.95
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 97.93
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 97.92
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 97.91
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.88
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 97.87
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.86
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 97.81
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 97.8
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 97.78
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 97.77
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 97.77
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 97.76
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 97.68
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 97.68
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 97.66
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 97.63
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 97.62
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 97.57
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 97.52
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 97.52
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 97.44
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 97.43
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 97.41
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 97.37
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 97.37
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.36
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 97.32
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 97.3
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 97.26
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 97.22
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.21
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 97.19
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.19
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 97.15
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.15
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 97.11
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 97.1
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 97.09
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 97.07
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 97.07
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 97.06
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 97.06
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 97.05
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 97.05
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 96.98
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 96.97
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 96.97
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 96.94
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 96.94
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.93
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 96.91
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 96.89
d1id1a_153 Rck domain from putative potassium channel Kch {Es 96.88
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.87
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 96.87
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 96.8
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.78
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 96.77
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 96.77
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.72
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 96.7
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 96.66
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 96.66
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.62
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 96.61
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 96.6
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 96.6
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 96.59
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 96.59
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 96.57
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 96.54
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 96.51
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.5
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 96.49
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 96.45
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 96.42
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 96.42
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 96.4
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 96.37
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 96.35
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.34
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 96.27
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 96.27
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 96.22
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 96.15
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 96.14
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 96.12
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.11
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 96.1
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 96.09
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.08
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 96.06
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.06
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 96.05
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.04
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.02
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 96.01
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 95.98
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 95.92
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 95.91
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 95.91
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 95.87
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 95.85
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 95.84
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 95.82
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 95.77
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.73
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 95.71
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 95.68
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 95.65
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.65
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 95.63
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 95.63
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 95.6
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 95.57
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 95.51
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 95.5
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.5
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 95.44
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 95.41
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.32
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 95.32
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 95.29
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.28
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 95.28
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.26
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 95.25
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.23
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.2
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 95.16
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 95.16
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 95.13
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 95.13
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 95.11
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 95.07
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 95.06
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 95.05
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.04
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 95.01
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.0
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 94.97
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 94.96
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.95
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.88
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 94.87
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 94.86
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 94.74
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 94.71
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 94.6
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.52
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 94.5
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 94.45
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.41
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 94.4
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 94.38
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.34
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 94.33
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 94.3
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 94.3
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 94.3
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 94.26
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.23
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 94.22
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.2
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 94.2
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 94.14
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.14
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 94.11
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 94.06
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 93.99
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 93.87
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 93.82
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 93.8
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.78
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 93.78
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.63
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.55
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 93.52
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 93.47
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 93.31
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 93.25
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 93.18
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.09
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 93.03
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 93.02
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 92.99
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 92.97
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 92.94
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 92.92
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 92.87
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 92.86
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.84
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 92.81
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 92.8
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 92.72
d1jbqa_355 Cystathionine beta-synthase {Human (Homo sapiens) 92.64
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.61
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 92.59
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 92.58
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 92.52
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 92.5
d1v71a1318 Hypothetical protein C320.14 (SPCC320.14, SPCC330. 92.47
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 92.32
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 92.2
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 92.14
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 92.1
d1id1a_153 Rck domain from putative potassium channel Kch {Es 92.08
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 91.91
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 91.82
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 91.76
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 91.75
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 91.7
d1y7la1310 O-acetylserine sulfhydrylase (Cysteine synthase) { 91.68
d1tdja1331 Threonine deaminase {Escherichia coli [TaxId: 562] 91.66
d2bhsa1292 O-acetylserine sulfhydrylase (Cysteine synthase) { 91.64
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 91.62
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 91.52
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 91.48
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 91.48
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 91.46
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 91.39
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 91.38
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 91.36
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 91.32
d1z7wa1320 O-acetylserine sulfhydrylase (Cysteine synthase) { 91.31
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 91.14
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 91.12
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 91.11
d1wkva1382 O-acetylserine sulfhydrylase (Cysteine synthase) { 91.01
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 91.0
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 90.93
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 90.8
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 90.8
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 90.74
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 90.65
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 90.42
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 90.42
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 90.3
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 90.27
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 89.99
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 89.87
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 89.85
d1zn7a1178 Adenine PRTase {Human (Homo sapiens) [TaxId: 9606] 89.78
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 89.64
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 89.38
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 89.28
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 89.24
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 89.24
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 89.18
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 89.14
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 89.13
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 88.89
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 88.72
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 88.68
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 88.61
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 88.56
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 88.54
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 88.44
d1p5ja_319 L-serine dehydratase {Human (Homo sapiens) [TaxId: 88.19
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 87.99
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 87.83
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 87.67
d1qb7a_236 Adenine PRTase {Leishmania donovani [TaxId: 5661]} 87.61
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 87.38
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 87.33
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 87.28
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 87.25
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 87.22
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 87.17
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 87.11
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 87.03
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 86.97
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 86.79
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 86.77
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 86.62
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 86.5
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 86.42
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 86.4
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 86.39
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 86.36
d1fcja_302 O-acetylserine sulfhydrylase (Cysteine synthase) { 86.18
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 86.1
d1euca1130 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 86.05
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 85.99
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 85.91
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 85.76
d1g2qa_178 Adenine PRTase {Baker's yeast (Saccharomyces cerev 85.75
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 85.74
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 85.26
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 85.16
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 84.88
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 84.78
d2csua3163 Acetate-CoA ligase alpha chain, AcdA, domains 2 an 84.27
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 84.13
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 83.82
d1v7ca_351 Threonine synthase {Thermus thermophilus [TaxId: 2 83.8
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 83.76
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 83.74
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 83.62
d1e5xa_ 477 Threonine synthase {Mouse-ear cress (Arabidopsis t 83.2
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 82.81
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 82.37
d1oi7a1121 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 81.99
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 81.91
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 81.78
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 81.37
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 81.29
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 81.06
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 81.01
d1neka2 330 Succinate dehydogenase {Escherichia coli [TaxId: 5 80.99
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 80.98
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 80.86
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Alcohol dehydrogenase-like, C-terminal domain
domain: Putative enoyl reductase domain of polyketide synthase
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=99.96  E-value=1.6e-29  Score=177.23  Aligned_cols=161  Identities=19%  Similarity=0.231  Sum_probs=136.8

Q ss_pred             cccccCCCCCCEEEEeCCCcHHHHHHHHHHHHCCCcEEEEecCcccHHHHHHHHHhcCCceEeCh--hHHHh-HHHhhCC
Q psy2961           2 LKDYNSLSPGDVVIQNGANSACGQNVIQIARHWGLKTINIVRNRDDIDKLKSYLKSLGADYVFTE--EELRN-ISRDASI   78 (202)
Q Consensus         2 l~~~~~~~~g~~VlI~g~~~~vG~~~i~la~~~g~~vi~~~~~~~~~~~~~~~~~~lg~~~v~~~--~~~~~-~~~~~~~   78 (202)
                      |.+.+++++|++|||+|++|++|++++|+|+.+|+++++++++++    +.+.++++|+++++++  +++.+ +++.+++
T Consensus        17 l~~~~~~~~g~~VlI~ga~g~vG~~~iqla~~~g~~vi~~~~~~~----~~~~l~~~Ga~~vi~~~~~~~~~~v~~~t~~   92 (183)
T d1pqwa_          17 LCEVGRLSPGERVLIHSATGGVGMAAVSIAKMIGARIYTTAGSDA----KREMLSRLGVEYVGDSRSVDFADEILELTDG   92 (183)
T ss_dssp             HHTTSCCCTTCEEEETTTTSHHHHHHHHHHHHHTCEEEEEESSHH----HHHHHHTTCCSEEEETTCSTHHHHHHHHTTT
T ss_pred             HHHHhCCCCCCEEEEECCCCCcccccchhhccccccceeeecccc----cccccccccccccccCCccCHHHHHHHHhCC
Confidence            567889999999999999889999999999999999999998875    6899999999999975  45777 9999988


Q ss_pred             CCCeEEEecCCCchHHHHHHhcccCcEEEEEeccCCCCcCCCcccccccCeeEEEEechhHhhhcccHHHHHHHHHHHHH
Q psy2961          79 PKPKLALNCVGGNSATNLLRTLVSKGVMVTYGGMSREPVQIPTSAFIFKDITLRGHWMTRWQKENKESAERKSMMNELTE  158 (202)
Q Consensus        79 ~~~d~vid~~g~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~  158 (202)
                      .++|++|||+|++.+..++++|+++|+++.+|.............++.+++++.++.+..+...++  ...++.++++.+
T Consensus        93 ~g~d~v~d~~g~~~~~~~~~~l~~~G~~v~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~v~~  170 (183)
T d1pqwa_          93 YGVDVVLNSLAGEAIQRGVQILAPGGRFIELGKKDVYADASLGLAALAKSASFSVVDLDLNLKLQP--ARYRQLLQHILQ  170 (183)
T ss_dssp             CCEEEEEECCCTHHHHHHHHTEEEEEEEEECSCGGGTTTCEEEGGGGTTTCEEEECCHHHHHHHCH--HHHHHHHHHHHH
T ss_pred             CCEEEEEecccchHHHHHHHHhcCCCEEEEEccCCCCCCcccchHHHhCCcEEEEEEccceeccCH--HHHHHHHHHHHH
Confidence            999999999999888889999999999999986554333223334557899999998777665443  667889999999


Q ss_pred             HHHcCCCCCC
Q psy2961         159 MMRTGKLAAP  168 (202)
Q Consensus       159 ~~~~g~~~~~  168 (202)
                      ++++|+++|.
T Consensus       171 ~i~~G~i~p~  180 (183)
T d1pqwa_         171 HVADGKLEVL  180 (183)
T ss_dssp             HHHTTSSCCC
T ss_pred             HHHCCCCcee
Confidence            9999999985



>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2csua3 c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure