Diaphorina citri psyllid: psy2964


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
RFDRGNCNCYGLIVPKSKREGRQKEEEEEGKKEKKEEEEEKKERNEELDRRRRRRRRRDNWVCDGSSNLAITRSIFFLGSLLGGFILSWVADRYGRITAVLGSHVVSFLGVALTPFSKDVVLFSLSRFLTGVGHFNAFIFYYIIVLECVGPKWRTFAMTFPFLIFYTVSEVALPWIAYYLADWQWISVITIFPLIVGLIVAIFTPESA
ccccccccEEEccccccccccccccccHHccccccccccccccccEEEccccccEEEEEEEECcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEECcccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHEEccccc
******CNCYGLIVPKSKREGRQKE**********EEEEEKKERNEELDRRRRRRRRRDNWVCDGSSNLAITRSIFFLGSLLGGFILSWVADRYGRITAVLGSHVVSFLGVALTPFSKDVVLFSLSRFLTGVGHFNAFIFYYIIVLECVGPKWRTFAMTFPFLIFYTVSEVALPWIAYYLADWQWISVITIFPLIVGLIVAIFTPESA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RFDRGNCNCYGLIVPKSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDNWVCDGSSNLAITRSIFFLGSLLGGFILSWVADRYGRITAVLGSHVVSFLGVALTPFSKDVVLFSLSRFLTGVGHFNAFIFYYIIVLECVGPKWRTFAMTFPFLIFYTVSEVALPWIAYYLADWQWISVITIFPLIVGLIVAIFTPESA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006812 [BP]cation transportprobableGO:0006811, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PW4, chain A
Confidence level:confident
Coverage over the Query: 52-208
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 15-59
View the alignment between query and template
View the model in PyMOL