Psyllid ID: psy2964


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
RFDRGNCNCYGLIVPKSKREGRQKEEEEEGKKEKKEEEEEKKERNEELDRRRRRRRRRDNWVCDGSSNLAITRSIFFLGSLLGGFILSWVADRYGRITAVLGSHVVSFLGVALTPFSKDVVLFSLSRFLTGVGHFNAFIFYYIIVLECVGPKWRTFAMTFPFLIFYTVSEVALPWIAYYLADWQWISVITIFPLIVGLIVAIFTPESA
ccccccccEEEccccccccccccccccHHccccccccccccccccEEEccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHEEccccc
ccccccccEEEEEccccccccccccccccccccccccccccccccEEEccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
rfdrgncncyglivpkskregrqkeeeEEGKKEKKEEEEEKKERNEELDRRRRRrrrrdnwvcdgssnlaiTRSIFFLGSLLGGFILSWVADRYGRITAVLGSHVVSFLGvaltpfskDVVLFSLSRfltgvghfNAFIFYYIIVLECvgpkwrtfamtFPFLIFYTVSEVALPWIAYYLADWQWISVITIFPLIVGLIVAIFTPESA
rfdrgncncyglivpkskregrqkeeeeegkkekkeeeeekkerneeldrrrrrrrrrdnwvcdgssnlaitRSIFFLGSLLGGFILSWVADRYGRITAVLGSHVVSFLGVALTPFSKDVVLFSLSRFLTGVGHFNAFIFYYIIVLECVGPKWRTFAMTFPFLIFYTVSEVALPWIAYYLADWQWISVITIFPLIVGLIVAIFTPESA
RFDRGNCNCYGLIVPKSkregrqkeeeeegkkekkeeeeekkerneeldrrrrrrrrrDNWVCDGSSNLAITRsifflgsllggfilsWVADRYGRITAVLGSHVVSFLGVALTPFSKDVVLFSLSRFLTGVGHFNAFIFYYIIVLECVGPKWRTFAMTFPFLIFYTVSEVALPWIAYYLADWQWISVITIFPLIVGLIVAIFTPESA
***********************************************************NWVCDGSSNLAITRSIFFLGSLLGGFILSWVADRYGRITAVLGSHVVSFLGVALTPFSKDVVLFSLSRFLTGVGHFNAFIFYYIIVLECVGPKWRTFAMTFPFLIFYTVSEVALPWIAYYLADWQWISVITIFPLIVGLIVAIFT****
******CNCYGLIVPKSKREGRQKEEEEEGKKEKKEEEEEKKERNEELDRRRRRRRRRDNWVCDGSSNLAITRSIFFLGSLLGGFILSWVADRYGRITAVLGSHVVSFLGVALTPFSKDVVLFSLSRFLTGVGHFNAFIFYYIIVLECVGPKWRTFAMTFPFLIFYTVSEVALPWIAYYLADWQWISVITIFPLIVGLIVAIFTPESA
RFDRGNCNCYGLIVPKS***************************************RRDNWVCDGSSNLAITRSIFFLGSLLGGFILSWVADRYGRITAVLGSHVVSFLGVALTPFSKDVVLFSLSRFLTGVGHFNAFIFYYIIVLECVGPKWRTFAMTFPFLIFYTVSEVALPWIAYYLADWQWISVITIFPLIVGLIVAIFTPESA
*****NCNCYGLIVPKSKREGRQKE**********EEEEEKKERNEELDRRRRRRRRRDNWVCDGSSNLAITRSIFFLGSLLGGFILSWVADRYGRITAVLGSHVVSFLGVALTPFSKDVVLFSLSRFLTGVGHFNAFIFYYIIVLECVGPKWRTFAMTFPFLIFYTVSEVALPWIAYYLADWQWISVITIFPLIVGLIVAIFTPES*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RFDRGNCNCYGLIVPKSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDNWVCDGSSNLAITRSIFFLGSLLGGFILSWVADRYGRITAVLGSHVVSFLGVALTPFSKDVVLFSLSRFLTGVGHFNAFIFYYIIVLECVGPKWRTFAMTFPFLIFYTVSEVALPWIAYYLADWQWISVITIFPLIVGLIVAIFTPESA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query208 2.2.26 [Sep-21-2011]
Q95R48 567 Organic cation transporte no N/A 0.875 0.320 0.259 1e-14
Q9VCA2 548 Organic cation transporte no N/A 0.875 0.332 0.275 9e-14
O75751 556 Solute carrier family 22 yes N/A 0.706 0.264 0.337 3e-13
O88446 551 Solute carrier family 22 yes N/A 0.687 0.259 0.335 1e-12
Q9WTW5 551 Solute carrier family 22 yes N/A 0.687 0.259 0.335 1e-12
O76082 557 Solute carrier family 22 no N/A 0.692 0.258 0.309 1e-11
A9CB25 551 Solute carrier family 22 N/A N/A 0.711 0.268 0.277 5e-11
O08966 556 Solute carrier family 22 no N/A 0.701 0.262 0.302 6e-11
Q9H015 551 Solute carrier family 22 no N/A 0.711 0.268 0.277 6e-11
Q63089 556 Solute carrier family 22 no N/A 0.701 0.262 0.295 2e-10
>sp|Q95R48|OCTL_DROME Organic cation transporter-like protein OS=Drosophila melanogaster GN=Orct2 PE=2 SV=2 Back     alignment and function desciption
 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 83/185 (44%), Gaps = 3/185 (1%)

Query: 26  EEEEGKKEKKEEEEEKKERNEELDRRRRRRRRRDNW--VCDGSSNLAITRSIFFLGSLLG 83
           EE       +   E K   +   DR +        W  VC      A + S+F LG LLG
Sbjct: 85  EEYLNGSIPRSSNETKTCSSYVYDRSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLG 144

Query: 84  GFILSWVADRYGRITAVLGSHVVSFLGVALTPFSKDVVLFSLSRFLTGVGHFNAFIFYYI 143
             +   ++D+YGR   +  S V+  L   L   + +   ++ +R + G      F+  Y+
Sbjct: 145 SIVFGQLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVFLVAYV 204

Query: 144 IVLECVGPKWRTFAMTFPFLIFYTVSEVALPWIAYYLADWQWISVITIFPLIVGLIVAIF 203
           + +E VGP  R +A  F  ++F++V  +     AY++ DW+W+ +    P ++ +     
Sbjct: 205 VAMEMVGPDKRLYAGIF-VMMFFSVGFMLTAVFAYFVHDWRWLQIALTLPGLIFMFYYWI 263

Query: 204 TPESA 208
            PESA
Sbjct: 264 IPESA 268




Probably transports organic cations.
Drosophila melanogaster (taxid: 7227)
>sp|Q9VCA2|ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster GN=Orct PE=1 SV=1 Back     alignment and function description
>sp|O75751|S22A3_HUMAN Solute carrier family 22 member 3 OS=Homo sapiens GN=SLC22A3 PE=1 SV=1 Back     alignment and function description
>sp|O88446|S22A3_RAT Solute carrier family 22 member 3 OS=Rattus norvegicus GN=Slc22a3 PE=2 SV=1 Back     alignment and function description
>sp|Q9WTW5|S22A3_MOUSE Solute carrier family 22 member 3 OS=Mus musculus GN=Slc22a3 PE=2 SV=1 Back     alignment and function description
>sp|O76082|S22A5_HUMAN Solute carrier family 22 member 5 OS=Homo sapiens GN=SLC22A5 PE=1 SV=1 Back     alignment and function description
>sp|A9CB25|S22A4_PAPAN Solute carrier family 22 member 4 OS=Papio anubis GN=SLC22A4 PE=3 SV=1 Back     alignment and function description
>sp|O08966|S22A1_MOUSE Solute carrier family 22 member 1 OS=Mus musculus GN=Slc22a1 PE=2 SV=2 Back     alignment and function description
>sp|Q9H015|S22A4_HUMAN Solute carrier family 22 member 4 OS=Homo sapiens GN=SLC22A4 PE=1 SV=3 Back     alignment and function description
>sp|Q63089|S22A1_RAT Solute carrier family 22 member 1 OS=Rattus norvegicus GN=Slc22a1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
242010074 712 organic cation transporter, putative [Pe 0.716 0.209 0.469 6e-34
189235365 637 PREDICTED: similar to AGAP006609-PA [Tri 0.725 0.237 0.456 2e-33
158296157 720 AGAP006609-PA [Anopheles gambiae str. PE 0.711 0.205 0.459 2e-33
110763247 619 PREDICTED: organic cation transporter pr 0.879 0.295 0.382 2e-31
383856871 631 PREDICTED: organic cation transporter pr 0.711 0.234 0.452 2e-31
383851798 675 PREDICTED: organic cation transporter pr 0.937 0.288 0.358 4e-31
350420244 644 PREDICTED: organic cation transporter pr 0.711 0.229 0.452 5e-31
357624538 585 hypothetical protein KGM_08557 [Danaus p 0.716 0.254 0.422 9e-31
221330907 662 CG42269 [Drosophila melanogaster] gi|220 0.721 0.226 0.426 9e-31
307203492 642 Solute carrier family 22 member 5 [Harpe 0.716 0.232 0.402 1e-30
>gi|242010074|ref|XP_002425801.1| organic cation transporter, putative [Pediculus humanus corporis] gi|212509734|gb|EEB13063.1| organic cation transporter, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  149 bits (377), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%)

Query: 60  NWVCDGSSNLAITRSIFFLGSLLGGFILSWVADRYGRITAVLGSHVVSFLGVALTPFSKD 119
           NWVC+ S+  + ++S+FF+GS++GG I  WVADRYGRI A++G++ +  +G   T F ++
Sbjct: 247 NWVCENSALPSASQSVFFVGSIVGGLIFGWVADRYGRIPALVGTNFMGLIGGLATAFVQN 306

Query: 120 VVLFSLSRFLTGVGHFNAFIFYYIIVLECVGPKWRTFAMTFPFLIFYTVSEVALPWIAYY 179
              F   RFL G+   N F   YI+VLE VGPKWRTF       IF+T++ V LPW+A Y
Sbjct: 307 FWSFCFCRFLVGLSFDNCFTMMYILVLEYVGPKWRTFVANMSIAIFFTIATVILPWLALY 366

Query: 180 LADWQWISVITIFPLIVGLIVAIFTPESA 208
           +ADW+  S+IT  PLIV  +     PESA
Sbjct: 367 VADWRIFSIITSLPLIVACLTPWLIPESA 395




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189235365|ref|XP_967323.2| PREDICTED: similar to AGAP006609-PA [Tribolium castaneum] gi|270004239|gb|EFA00687.1| hypothetical protein TcasGA2_TC003564 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|158296157|ref|XP_316638.4| AGAP006609-PA [Anopheles gambiae str. PEST] gi|157016379|gb|EAA11678.4| AGAP006609-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|110763247|ref|XP_394110.3| PREDICTED: organic cation transporter protein-like [Apis mellifera] Back     alignment and taxonomy information
>gi|383856871|ref|XP_003703930.1| PREDICTED: organic cation transporter protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|383851798|ref|XP_003701418.1| PREDICTED: organic cation transporter protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350420244|ref|XP_003492447.1| PREDICTED: organic cation transporter protein-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|357624538|gb|EHJ75271.1| hypothetical protein KGM_08557 [Danaus plexippus] Back     alignment and taxonomy information
>gi|221330907|ref|NP_648019.2| CG42269 [Drosophila melanogaster] gi|220902482|gb|AAF50706.2| CG42269 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|307203492|gb|EFN82543.1| Solute carrier family 22 member 5 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
FB|FBgn0259164 662 CG42269 [Drosophila melanogast 0.716 0.225 0.375 5.2e-25
FB|FBgn0035647 706 CG10486 [Drosophila melanogast 0.711 0.209 0.304 2.7e-17
FB|FBgn0038720 585 CG6231 [Drosophila melanogaste 0.716 0.254 0.302 2.1e-15
FB|FBgn0038718 538 CG17752 [Drosophila melanogast 0.706 0.273 0.292 2.9e-15
FB|FBgn0035645 540 CG5592 [Drosophila melanogaste 0.711 0.274 0.270 8e-15
FB|FBgn0038716 540 CG7342 [Drosophila melanogaste 0.711 0.274 0.270 1.7e-14
FB|FBgn0038717 533 CG17751 [Drosophila melanogast 0.711 0.277 0.290 2.7e-14
FB|FBgn0038719 545 CG16727 [Drosophila melanogast 0.711 0.271 0.277 3.4e-13
FB|FBgn0038261 557 CG14856 [Drosophila melanogast 0.701 0.262 0.296 3.5e-13
FB|FBgn0038715 541 CG7333 [Drosophila melanogaste 0.711 0.273 0.263 1.5e-12
FB|FBgn0259164 CG42269 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 293 (108.2 bits), Expect = 5.2e-25, P = 5.2e-25
 Identities = 56/149 (37%), Positives = 82/149 (55%)

Query:    60 NWVCDGSSNLAITRXXXXXXXXXXXXXXXWVADRYGRITAVLGSHVVSFLGVALTPFSKD 119
             NWVCD ++     +               WVADR+GRI A++G++++  L    T F  +
Sbjct:   195 NWVCDDAALPTYAQSIFFLGAIVGGLLFGWVADRFGRIPALIGTNMMGLLAGVGTAFVSN 254

Query:   120 VVLFSLSRFLTGVGHFNAFIFYYIIVLECVGPKWRTFAMTFPFLIFYTVSEVALPWIAYY 179
                F++ RF  G    N F   YI+VLE VGPK+RTF       IF+T +   LPWIAY+
Sbjct:   255 FWEFAIMRFFVGFAFDNCFTMMYILVLEYVGPKYRTFVANMSIAIFFTGAACLLPWIAYF 314

Query:   180 LADWQWISVITIFPLIVGLIVAIFTPESA 208
             LADW+ ++++T  PL++ +      PESA
Sbjct:   315 LADWKLLAIVTSAPLLLAIFTPFVVPESA 343




GO:0008513 "secondary active organic cation transmembrane transporter activity" evidence=ISS
GO:0055085 "transmembrane transport" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
FB|FBgn0035647 CG10486 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038720 CG6231 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038718 CG17752 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0035645 CG5592 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038716 CG7342 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038717 CG17751 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038719 CG16727 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038261 CG14856 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038715 CG7333 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
TIGR00898 505 TIGR00898, 2A0119, cation transport protein 3e-24
cd06174 352 cd06174, MFS, The Major Facilitator Superfamily (M 3e-17
TIGR00895 398 TIGR00895, 2A0115, benzoate transport 1e-13
pfam07690 346 pfam07690, MFS_1, Major Facilitator Superfamily 2e-12
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 4e-11
pfam00083 449 pfam00083, Sugar_tr, Sugar (and other) transporter 6e-09
PRK11551 406 PRK11551, PRK11551, putative 3-hydroxyphenylpropio 6e-07
COG0477 338 COG0477, ProP, Permeases of the major facilitator 3e-06
TIGR00891 405 TIGR00891, 2A0112, putative sialic acid transporte 6e-06
pfam07690346 pfam07690, MFS_1, Major Facilitator Superfamily 8e-05
TIGR01299 742 TIGR01299, synapt_SV2, synaptic vesicle protein SV 9e-05
COG2814 394 COG2814, AraJ, Arabinose efflux permease [Carbohyd 1e-04
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 1e-04
pfam14265125 pfam14265, DUF4355, Domain of unknown function (DU 2e-04
TIGR00893 399 TIGR00893, 2A0114, D-galactonate transporter 2e-04
TIGR00879 481 TIGR00879, SP, MFS transporter, sugar porter (SP) 3e-04
pfam02029431 pfam02029, Caldesmon, Caldesmon 7e-04
pfam08597242 pfam08597, eIF3_subunit, Translation initiation fa 7e-04
pfam13904261 pfam13904, DUF4207, Domain of unknown function (DU 8e-04
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 8e-04
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.001
PRK12307 426 PRK12307, PRK12307, putative sialic acid transport 0.001
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 0.002
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 0.002
pfam09507427 pfam09507, CDC27, DNA polymerase subunit Cdc27 0.003
TIGR00880141 TIGR00880, 2_A_01_02, Multidrug resistance protein 0.003
pfam1302570 pfam13025, DUF3886, Protein of unknown function (D 0.003
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 0.004
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.004
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 0.004
pfam09756189 pfam09756, DDRGK, DDRGK domain 0.004
PRK10473 392 PRK10473, PRK10473, multidrug efflux system protei 0.004
pfam1330088 pfam13300, DUF4078, Domain of unknown function (DU 0.004
>gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein Back     alignment and domain information
 Score = 98.9 bits (247), Expect = 3e-24
 Identities = 45/149 (30%), Positives = 84/149 (56%), Gaps = 1/149 (0%)

Query: 60  NWVCDGSSNLAITRSIFFLGSLLGGFILSWVADRYGRITAVLGSHVVSFLGVALTPFSKD 119
           + VC+ +  + +T+S FF+G LLG F+  +++DR+GR   +L S +V+ +   LT FS +
Sbjct: 120 DLVCEDAWKVDLTQSCFFVGVLLGSFVFGYLSDRFGRKKVLLLSTLVTAVSGVLTAFSPN 179

Query: 120 VVLFSLSRFLTGVGHFNAFIFYYIIVLECVGPKWRTFAMTFPFLIFYTVSEVALPWIAYY 179
             +F + R L G+G    ++   ++  E +  K R    T    +F+++  V LP +AY+
Sbjct: 180 YTVFLVFRLLVGMGIGGIWVQAVVLNTEFLPKKQRAIVGTLIQ-VFFSLGLVLLPLVAYF 238

Query: 180 LADWQWISVITIFPLIVGLIVAIFTPESA 208
           + DW+W+ +    P  +  +++ F PES 
Sbjct: 239 IPDWRWLQLAVSLPTFLFFLLSWFVPESP 267


[Transport and binding proteins, Cations and iron carrying compounds]. Length = 505

>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|233175 TIGR00895, 2A0115, benzoate transport Back     alignment and domain information
>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
>gnl|CDD|236927 PRK11551, PRK11551, putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>gnl|CDD|223553 COG0477, ProP, Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|233172 TIGR00891, 2A0112, putative sialic acid transporter Back     alignment and domain information
>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
>gnl|CDD|130366 TIGR01299, synapt_SV2, synaptic vesicle protein SV2 Back     alignment and domain information
>gnl|CDD|225371 COG2814, AraJ, Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) Back     alignment and domain information
>gnl|CDD|233174 TIGR00893, 2A0114, D-galactonate transporter Back     alignment and domain information
>gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family Back     alignment and domain information
>gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|237051 PRK12307, PRK12307, putative sialic acid transporter; Provisional Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 Back     alignment and domain information
>gnl|CDD|233166 TIGR00880, 2_A_01_02, Multidrug resistance protein Back     alignment and domain information
>gnl|CDD|205206 pfam13025, DUF3886, Protein of unknown function (DUF3886) Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|182486 PRK10473, PRK10473, multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>gnl|CDD|205480 pfam13300, DUF4078, Domain of unknown function (DUF4078) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 208
TIGR00898 505 2A0119 cation transport protein. 99.89
KOG0255|consensus 521 99.87
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.87
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 99.87
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 99.85
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.84
PRK15403 413 multidrug efflux system protein MdtM; Provisional 99.83
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.83
PRK03545 390 putative arabinose transporter; Provisional 99.83
PRK10642 490 proline/glycine betaine transporter; Provisional 99.83
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 99.83
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.83
PRK10213 394 nepI ribonucleoside transporter; Reviewed 99.82
TIGR00891 405 2A0112 putative sialic acid transporter. 99.81
PRK10406 432 alpha-ketoglutarate transporter; Provisional 99.8
PRK10091 382 MFS transport protein AraJ; Provisional 99.8
KOG0569|consensus 485 99.8
PRK11663 434 regulatory protein UhpC; Provisional 99.8
PRK12307 426 putative sialic acid transporter; Provisional 99.8
KOG0254|consensus 513 99.79
TIGR00893 399 2A0114 d-galactonate transporter. 99.79
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 99.79
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.78
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.78
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.78
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.78
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 99.78
PRK09952 438 shikimate transporter; Provisional 99.77
PRK09705 393 cynX putative cyanate transporter; Provisional 99.77
PRK10473 392 multidrug efflux system protein MdtL; Provisional 99.77
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 99.76
TIGR00900 365 2A0121 H+ Antiporter protein. 99.76
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 99.76
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.76
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 99.75
PRK11652 394 emrD multidrug resistance protein D; Provisional 99.75
PRK03893 496 putative sialic acid transporter; Provisional 99.75
KOG2615|consensus 451 99.75
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 99.75
PRK11195 393 lysophospholipid transporter LplT; Provisional 99.74
PRK12382 392 putative transporter; Provisional 99.74
PRK11043 401 putative transporter; Provisional 99.74
KOG1330|consensus 493 99.73
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.73
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.73
PRK10504 471 putative transporter; Provisional 99.73
PRK03699 394 putative transporter; Provisional 99.73
TIGR00895 398 2A0115 benzoate transport. 99.73
PLN00028 476 nitrate transmembrane transporter; Provisional 99.73
PRK15075 434 citrate-proton symporter; Provisional 99.72
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 99.72
PRK05122 399 major facilitator superfamily transporter; Provisi 99.72
PRK11646 400 multidrug resistance protein MdtH; Provisional 99.72
TIGR00880141 2_A_01_02 Multidrug resistance protein. 99.71
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.71
KOG2532|consensus 466 99.71
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.71
PRK10054 395 putative transporter; Provisional 99.7
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 99.7
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 99.7
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 99.69
KOG2533|consensus 495 99.69
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 99.69
PRK10133 438 L-fucose transporter; Provisional 99.68
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.67
TIGR00892 455 2A0113 monocarboxylate transporter 1. 99.67
PRK09874 408 drug efflux system protein MdtG; Provisional 99.67
PRK03633 381 putative MFS family transporter protein; Provision 99.66
PRK10489 417 enterobactin exporter EntS; Provisional 99.66
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 99.66
TIGR00805 633 oat sodium-independent organic anion transporter. 99.65
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 99.64
KOG3764|consensus 464 99.64
PRK10207 489 dipeptide/tripeptide permease B; Provisional 99.64
TIGR00896 355 CynX cyanate transporter. This family of proteins 99.63
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.62
KOG0252|consensus 538 99.61
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.61
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.61
TIGR00897 402 2A0118 polyol permease family. This family of prot 99.61
PTZ00207 591 hypothetical protein; Provisional 99.59
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 99.58
PRK10642490 proline/glycine betaine transporter; Provisional 99.58
TIGR00901 356 2A0125 AmpG-related permease. 99.54
PRK15011393 sugar efflux transporter B; Provisional 99.53
PRK11902 402 ampG muropeptide transporter; Reviewed 99.53
PRK15011 393 sugar efflux transporter B; Provisional 99.52
PRK11010 491 ampG muropeptide transporter; Validated 99.51
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.51
KOG0253|consensus 528 99.5
PRK05122399 major facilitator superfamily transporter; Provisi 99.5
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.5
PRK09584 500 tppB putative tripeptide transporter permease; Rev 99.49
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.48
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.47
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.47
PRK09528420 lacY galactoside permease; Reviewed 99.47
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.46
PRK12382392 putative transporter; Provisional 99.45
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.45
PRK09952438 shikimate transporter; Provisional 99.44
TIGR00898505 2A0119 cation transport protein. 99.43
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 99.43
KOG0569|consensus485 99.43
PRK09874408 drug efflux system protein MdtG; Provisional 99.41
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 99.39
PRK10489417 enterobactin exporter EntS; Provisional 99.38
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 99.37
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.37
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.35
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.35
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 99.33
PRK03633381 putative MFS family transporter protein; Provision 99.33
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 99.33
KOG0253|consensus528 99.32
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.3
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.3
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.29
PRK09528 420 lacY galactoside permease; Reviewed 99.29
KOG2504|consensus 509 99.29
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.29
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.28
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 99.27
PRK03699394 putative transporter; Provisional 99.26
PRK03545390 putative arabinose transporter; Provisional 99.26
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.25
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 99.25
PRK09705393 cynX putative cyanate transporter; Provisional 99.24
TIGR00893399 2A0114 d-galactonate transporter. 99.24
TIGR00900365 2A0121 H+ Antiporter protein. 99.24
TIGR00897402 2A0118 polyol permease family. This family of prot 99.24
TIGR00891405 2A0112 putative sialic acid transporter. 99.21
PRK03893496 putative sialic acid transporter; Provisional 99.2
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 99.19
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.19
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 99.18
PRK15075434 citrate-proton symporter; Provisional 99.18
TIGR00895398 2A0115 benzoate transport. 99.17
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.16
PRK11010491 ampG muropeptide transporter; Validated 99.15
PRK12307426 putative sialic acid transporter; Provisional 99.15
COG2270438 Permeases of the major facilitator superfamily [Ge 99.13
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.11
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.1
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.08
KOG2325|consensus 488 99.08
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 99.07
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.07
PRK10504471 putative transporter; Provisional 99.06
PRK11663434 regulatory protein UhpC; Provisional 99.05
TIGR00788 468 fbt folate/biopterin transporter. The only functio 99.05
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 99.04
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.02
PLN00028476 nitrate transmembrane transporter; Provisional 98.98
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 98.98
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 98.97
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 98.96
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 98.96
PRK10054395 putative transporter; Provisional 98.95
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.95
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 98.95
TIGR00881379 2A0104 phosphoglycerate transporter family protein 98.94
PRK10213394 nepI ribonucleoside transporter; Reviewed 98.94
PRK15402406 multidrug efflux system translocase MdfA; Provisio 98.94
TIGR00901356 2A0125 AmpG-related permease. 98.93
PRK14995495 methyl viologen resistance protein SmvA; Provision 98.92
PRK11902402 ampG muropeptide transporter; Reviewed 98.92
PF05631 354 DUF791: Protein of unknown function (DUF791); Inte 98.92
PRK11646400 multidrug resistance protein MdtH; Provisional 98.91
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 98.91
PRK10091382 MFS transport protein AraJ; Provisional 98.91
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 98.91
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 98.9
PRK11195393 lysophospholipid transporter LplT; Provisional 98.89
COG0477 338 ProP Permeases of the major facilitator superfamil 98.89
KOG2504|consensus509 98.86
TIGR01272310 gluP glucose/galactose transporter. Disruption of 98.86
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 98.85
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 98.85
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 98.85
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 98.83
KOG0254|consensus513 98.82
PRK09669 444 putative symporter YagG; Provisional 98.8
TIGR00896355 CynX cyanate transporter. This family of proteins 98.8
KOG2816|consensus 463 98.77
PRK09848448 glucuronide transporter; Provisional 98.76
PRK10133438 L-fucose transporter; Provisional 98.76
KOG3762|consensus618 98.71
PF13347428 MFS_2: MFS/sugar transport protein 98.71
TIGR00788468 fbt folate/biopterin transporter. The only functio 98.7
PRK10473392 multidrug efflux system protein MdtL; Provisional 98.69
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 98.68
PRK09669444 putative symporter YagG; Provisional 98.67
PRK10429 473 melibiose:sodium symporter; Provisional 98.65
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 98.65
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 98.64
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 98.63
PF03825 400 Nuc_H_symport: Nucleoside H+ symporter 98.63
PRK10429473 melibiose:sodium symporter; Provisional 98.62
PRK11043401 putative transporter; Provisional 98.6
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 98.58
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 98.57
KOG4686|consensus459 98.56
KOG0255|consensus521 98.56
PRK09584500 tppB putative tripeptide transporter permease; Rev 98.55
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 98.53
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 98.51
KOG0252|consensus538 98.48
PRK10207489 dipeptide/tripeptide permease B; Provisional 98.43
PRK11652394 emrD multidrug resistance protein D; Provisional 98.4
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 98.39
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.39
PRK11462 460 putative transporter; Provisional 98.38
KOG2563|consensus 480 98.38
PF13347 428 MFS_2: MFS/sugar transport protein 98.37
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.33
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 98.32
KOG3764|consensus464 98.29
PRK11462460 putative transporter; Provisional 98.25
COG2807395 CynX Cyanate permease [Inorganic ion transport and 98.25
PRK09848 448 glucuronide transporter; Provisional 98.24
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 98.23
COG2211467 MelB Na+/melibiose symporter and related transport 98.17
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.1
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 98.06
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.03
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 98.02
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 98.0
KOG2532|consensus466 97.97
COG2211 467 MelB Na+/melibiose symporter and related transport 97.92
COG0738422 FucP Fucose permease [Carbohydrate transport and m 97.83
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 97.75
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.72
PRK15462493 dipeptide/tripeptide permease D; Provisional 97.67
KOG4686|consensus 459 97.64
KOG2816|consensus463 97.59
KOG3626|consensus 735 97.59
KOG2533|consensus495 97.57
PF1283277 MFS_1_like: MFS_1 like family 97.48
PRK15403413 multidrug efflux system protein MdtM; Provisional 97.46
KOG3098|consensus 461 97.45
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 97.41
KOG2615|consensus451 97.39
COG2270 438 Permeases of the major facilitator superfamily [Ge 97.35
PTZ00207591 hypothetical protein; Provisional 97.28
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 97.24
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.19
KOG4332|consensus 454 97.06
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 96.6
KOG0637|consensus 498 96.48
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 96.43
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 96.4
PRK03612 521 spermidine synthase; Provisional 95.98
PF02487 402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 95.86
KOG1330|consensus493 95.75
KOG3098|consensus461 95.7
KOG1237|consensus 571 95.56
KOG3762|consensus 618 94.09
KOG1479|consensus406 93.44
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 93.31
KOG3810|consensus 433 93.03
PF07672267 MFS_Mycoplasma: Mycoplasma MFS transporter; InterP 92.55
KOG3880|consensus409 91.08
TIGR00939437 2a57 Equilibrative Nucleoside Transporter (ENT). 90.07
TIGR00806511 rfc RFC reduced folate carrier. Proteins of the RF 89.59
KOG2563|consensus480 89.34
PF03137539 OATP: Organic Anion Transporter Polypeptide (OATP) 87.69
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 87.26
TIGR00939 437 2a57 Equilibrative Nucleoside Transporter (ENT). 86.66
KOG3097|consensus 390 86.61
KOG3574|consensus 510 86.36
PF13000 544 Acatn: Acetyl-coenzyme A transporter 1; InterPro: 85.18
KOG4332|consensus454 84.4
KOG2325|consensus488 84.0
COG5336116 Uncharacterized protein conserved in bacteria [Fun 83.39
TIGR00805 633 oat sodium-independent organic anion transporter. 81.55
KOG0637|consensus498 80.71
KOG3810|consensus433 80.43
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
Probab=99.89  E-value=8.2e-22  Score=164.15  Aligned_cols=158  Identities=28%  Similarity=0.577  Sum_probs=145.6

Q ss_pred             hcccceeecccccccCCchHHHHHHHHHHHHHhHHHHHHHhhhhhCchHHHHHHHHHHHHHHHHHhhhccHHHHHHHHHH
Q psy2964          50 RRRRRRRRRDNWVCDGSSNLAITRSIFFLGSLLGGFILSWVADRYGRITAVLGSHVVSFLGVALTPFSKDVVLFSLSRFL  129 (208)
Q Consensus        50 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~l~dr~Grr~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  129 (208)
                      ...+++.+++++.|++..+.++..+++.++..+++++.|+++||+|||++++++.++..++.++.+++++++.+++.|++
T Consensus       110 ~~~~~i~~e~~l~c~~~~~~~~~~s~~~~g~~~g~~~~g~l~Dr~Grr~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~l  189 (505)
T TIGR00898       110 TFSSTIVTEWDLVCEDAWKVDLTQSCFFVGVLLGSFVFGYLSDRFGRKKVLLLSTLVTAVSGVLTAFSPNYTVFLVFRLL  189 (505)
T ss_pred             cccccEEEEecceechHHHHHHHHHHHHHHHHHHHHhHHHhhhhccchHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHH
Confidence            34578899999999889999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhhhhhHHHHHHHHHHhhcCCchhhhHHhHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHhccCCCC
Q psy2964         130 TGVGHFNAFIFYYIIVLECVGPKWRTFAMTFPFLIFYTVSEVALPWIAYYLADWQWISVITIFPLIVGLIVAIFTPESA  208 (208)
Q Consensus       130 ~g~~~~~~~~~~~~~~~e~~~~~~r~~~~~~~~~~~~~~g~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~petp  208 (208)
                      .|++.+...+....++.|++|+++|+.+.++ ...++.+|.+++|.++..+.+||+.+++.+++.++..+..+++||+|
T Consensus       190 ~G~~~~~~~~~~~~~~~e~~~~~~r~~~~~~-~~~~~~~g~~~~~~~~~~~~~wr~~~~~~~i~~~~~~~~~~~~~esp  267 (505)
T TIGR00898       190 VGMGIGGIWVQAVVLNTEFLPKKQRAIVGTL-IQVFFSLGLVLLPLVAYFIPDWRWLQLAVSLPTFLFFLLSWFVPESP  267 (505)
T ss_pred             HHhhccchHHHHHHHhheecChhhhHHHHHH-HHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHhcCCCh
Confidence            9999999999999999999999999999988 67788999999999998888999999998888777666667889986



>KOG0255|consensus Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>KOG4332|consensus Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>KOG1237|consensus Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>KOG1479|consensus Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>KOG3810|consensus Back     alignment and domain information
>PF07672 MFS_Mycoplasma: Mycoplasma MFS transporter; InterPro: IPR011699 These proteins share some similarity with members of the Major Facilitator Superfamily (MFS) Back     alignment and domain information
>KOG3880|consensus Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>KOG3097|consensus Back     alignment and domain information
>KOG3574|consensus Back     alignment and domain information
>PF13000 Acatn: Acetyl-coenzyme A transporter 1; InterPro: IPR024371 Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [, ] Back     alignment and domain information
>KOG4332|consensus Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>COG5336 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>KOG3810|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-06
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 1e-04
3k29_A169 Putative uncharacterized protein; YSCO, type III s 8e-04
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
 Score = 44.8 bits (105), Expect = 4e-06
 Identities = 12/59 (20%), Positives = 28/59 (47%), Gaps = 14/59 (23%)

Query: 15  PKSKREGRQK-----EEEEEGKKEKKEEEEEK---------KERNEELDRRRRRRRRRD 59
           P+S R+ R++     +E +   K  ++E  EK         + ++E++++ +   R  D
Sbjct: 84  PESIRKWREEQRKRLQELDAASKVMEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIAD 142


>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Length = 451 Back     alignment and structure
>3k29_A Putative uncharacterized protein; YSCO, type III secretion apparatus, S genomics, csgid; HET: MSE; 2.00A {Chlamydia trachomatis} Length = 169 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.85
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.83
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.81
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 99.81
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.76
2xut_A 524 Proton/peptide symporter family protein; transport 99.68
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.52
2cfq_A417 Lactose permease; transport, transport mechanism, 99.49
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.43
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.36
2cfq_A 417 Lactose permease; transport, transport mechanism, 99.26
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 99.19
2xut_A524 Proton/peptide symporter family protein; transport 98.65
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 98.6
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=99.85  E-value=2.1e-20  Score=153.43  Aligned_cols=142  Identities=19%  Similarity=0.335  Sum_probs=125.9

Q ss_pred             CchHHHHHHHHHHHHHhHHHHHHHhhhhhCchHHHHHHHHHHHHHHHHHh------------------hhccHHHHHHHH
Q psy2964          66 SSNLAITRSIFFLGSLLGGFILSWVADRYGRITAVLGSHVVSFLGVALTP------------------FSKDVVLFSLSR  127 (208)
Q Consensus        66 ~~~~~~~~~~~~~~~~~~~~~~g~l~dr~Grr~~l~~~~~~~~~~~~~~~------------------~~~~~~~~~~~~  127 (208)
                      +...+++.+.+.+|.++|++++|+++||+|||++++++.++..++.++++                  ++++++.++++|
T Consensus        54 ~~~~g~~~s~~~~G~~iG~~~~G~laDr~GRk~~l~~~~~l~~i~~i~~a~~~~~~~~~~~~~~~~~~~a~~~~~l~~~R  133 (491)
T 4gc0_A           54 NSLLGFCVASALIGCIIGGALGGYCSNRFGRRDSLKIAAVLFFISGVGSAWPELGFTSINPDNTVPVYLAGYVPEFVIYR  133 (491)
T ss_dssp             HHHHHHHHHTHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHHHHCTTTTTSCSSSSSSCCGGGGGCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHHHHhhhhhhhcchhHHHHHHhhhHHHHHHHH
Confidence            34578889999999999999999999999999999999999999998887                  468999999999


Q ss_pred             HHHhhhhhhHHHHHHHHHHhhcCCchhhhHHhHHHHHHHHHHHHHHHHHHHhhh-----------hhHHHHHHHHHHHHH
Q psy2964         128 FLTGVGHFNAFIFYYIIVLECVGPKWRTFAMTFPFLIFYTVSEVALPWIAYYLA-----------DWQWISVITIFPLIV  196 (208)
Q Consensus       128 ~l~g~~~~~~~~~~~~~~~e~~~~~~r~~~~~~~~~~~~~~g~~~~~~~~~~~~-----------~w~~~~~~~~~~~~~  196 (208)
                      +++|++.|...+..+.+++|..|+++|++..++ .+.+...|..+++.++....           .|++.+.+..++.++
T Consensus       134 ~l~G~g~G~~~~~~~~~i~E~~p~~~rg~~~~~-~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  212 (491)
T 4gc0_A          134 IIGGIGVGLASMLSPMYIAELAPAHIRGKLVSF-NQFAIIFGQLLVYCVNYFIARSGDASWLNTDGWRYMFASECIPALL  212 (491)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTSCGGGHHHHHHH-HHHHHHHHHHHHHHHHHHHHTTSCTTTTTTTHHHHHHHTTHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHhhCCHHhhhhhHHh-hhhhhhhhhhhhhhcchhhccccccccccchhhHHHhhhhhhhhhh
Confidence            999999999999999999999999999999988 77788888888877776542           577777777778888


Q ss_pred             HHHHHhccCCCC
Q psy2964         197 GLIVAIFTPESA  208 (208)
Q Consensus       197 ~~~~~~~~petp  208 (208)
                      .++..++.||||
T Consensus       213 ~~~~~~~~peSp  224 (491)
T 4gc0_A          213 FLMLLYTVPESP  224 (491)
T ss_dssp             HHHHGGGSCCCH
T ss_pred             hhhhhhcCCCCh
Confidence            888888999997



>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 208
d1pw4a_ 447 f.38.1.1 (A:) Glycerol-3-phosphate transporter {Es 5e-11
d1pv7a_ 417 f.38.1.2 (A:) Lactose permease {Escherichia coli [ 1e-06
d1pv7a_417 f.38.1.2 (A:) Lactose permease {Escherichia coli [ 4e-04
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 9e-04
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 0.003
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 0.003
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Length = 447 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
 Score = 58.9 bits (141), Expect = 5e-11
 Identities = 18/142 (12%), Positives = 41/142 (28%), Gaps = 4/142 (2%)

Query: 66  SSNLAITRSIFFLGSLLGGFILSWVADRYGR----ITAVLGSHVVSFLGVALTPFSKDVV 121
             +L    S   +      FI+  V+DR          ++ +  V      +   +  + 
Sbjct: 58  RGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSIA 117

Query: 122 LFSLSRFLTGVGHFNAFIFYYIIVLECVGPKWRTFAMTFPFLIFYTVSEVALPWIAYYLA 181
           +  +  FL G      +      ++     K R   ++           +        +A
Sbjct: 118 VMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMA 177

Query: 182 DWQWISVITIFPLIVGLIVAIF 203
            +         P    ++VA+F
Sbjct: 178 WFNDWHAALYMPAFCAILVALF 199


>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Length = 417 Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Length = 417 Back     information, alignment and structure
>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.8
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.58
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.36
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 99.28
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.80  E-value=4.3e-19  Score=141.30  Aligned_cols=147  Identities=14%  Similarity=0.104  Sum_probs=126.0

Q ss_pred             ecccccccCCchHHHHHHHHHHHHHhHHHHHHHhhhhhCchHHHHHHHHHHHHHHHHHhhh----ccHHHHHHHHHHHhh
Q psy2964          57 RRDNWVCDGSSNLAITRSIFFLGSLLGGFILSWVADRYGRITAVLGSHVVSFLGVALTPFS----KDVVLFSLSRFLTGV  132 (208)
Q Consensus        57 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~l~dr~Grr~~l~~~~~~~~~~~~~~~~~----~~~~~~~~~~~l~g~  132 (208)
                      .++++   +..+.+++.+++.++..++++++|+++||+|||+++..+.++.+++.+++++.    ++++.+++.|++.|+
T Consensus        52 ~~~g~---s~~~~g~~~s~~~~~~~~~~~~~G~l~Dr~g~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~  128 (447)
T d1pw4a_          52 VEQGF---SRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSIAVMFVLLFLCGW  128 (447)
T ss_dssp             TSSTT---CSSCHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHCHHHHSSSSHHHHHHHHHHH
T ss_pred             HHhCc---CHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCchHHHHHHHHHHHHHHhhccccchhhhhHHHHHHHHHHHHH
Confidence            45676   78899999999999999999999999999999999999999999988887765    477889999999999


Q ss_pred             hhhhHHHHHHHHHHhhcCCchhhhHHhHHHHHHHHHHHHHHHHHHHhhh----hhHHHHHHHHHHHHH-HHHHHhccCCC
Q psy2964         133 GHFNAFIFYYIIVLECVGPKWRTFAMTFPFLIFYTVSEVALPWIAYYLA----DWQWISVITIFPLIV-GLIVAIFTPES  207 (208)
Q Consensus       133 ~~~~~~~~~~~~~~e~~~~~~r~~~~~~~~~~~~~~g~~~~~~~~~~~~----~w~~~~~~~~~~~~~-~~~~~~~~pet  207 (208)
                      +.+...+....++.|++|+++|++++++ ++.+..+|..++|.++....    +|++.+++.+++.++ .++.+++.+|+
T Consensus       129 ~~~~~~~~~~~~i~~~~~~~~r~~~~~~-~~~~~~~g~~i~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~  207 (447)
T d1pw4a_         129 FQGMGWPPCGRTMVHWWSQKERGGIVSV-WNCAHNVGGGIPPLLFLLGMAWFNDWHAALYMPAFCAILVALFAFAMMRDT  207 (447)
T ss_dssp             HHHHTHHHHHHHHHTTCTTTHHHHHHHH-HHHHHHHHHTSHHHHHHHHHHHTCCSTTCTHHHHHHHHHHHHHHHHHCCCS
T ss_pred             hhhhhhhHHHHHHHHHHHhhcccccccc-cccccchhhhhhhhhhhhHhhhhhcccccchhhhhhHHHHHHHHHHhcccc
Confidence            9999999999999999999999999999 77788899888887776543    899988887766655 44455555554



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure