Diaphorina citri psyllid: psy2966

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------
LNWVCAQDTLPTLAQAIFFCGAIVGGLVFGWVADHFGRIPALVGTNLTGFVAGVATAFASTFWQFAICRFFVGLAFDNCFTMMYILVLEYVGPSWRTFVANMSIAIFFTLAASLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWLVSQGRVDEAVVIMKRFEKINNKKVDPKLYQQLKETCQRQAKQEIDGKRYSVLDLFRTPRLRNITCLLIVICAGVRGAIMAYICS
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcHHHHHHHHHHHHEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcc
LNWVCAQDTLPTLAQAIFFCGAIVGGLVFGWVADHFGRIPALVGTNLTGFVAGVATAFASTFWQFAICRFFVGLAFDNCFTMMYILVLEYVGPSWRTFVANMSIAIFFTLAASLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWLVSQGRVDEAVVIMKRFEKINNKKVDPKLYQQLKETCQRQAKQEIDGKRYSVLDLFRTPRLRNITCLLIVICAGVRGAIMAYICS
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LNWVCAQDTLPTLAQAIFFCGAIVGGLVFGWVADHFGRIPALVGTNLTGFVAGVATAFASTFWQFAICRFFVGLAFDNCFTMMYILVLEYVGPSWRTFVANMSIAIFFTLAASLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWLVSQGRVDEAVVIMKRFEKINNKKVDPKLYQQLKETCQRQAKQEIDGKRYSVLDLFRTPRLRNITCLLIVICAGVRGAIMAYICS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0015850 [BP]organic hydroxy compound transportprobableGO:0006810, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0009705 [CC]plant-type vacuole membraneprobableGO:0005737, GO:0005575, GO:0000325, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0046942 [BP]carboxylic acid transportprobableGO:0015849, GO:0006811, GO:0006810, GO:0006820, GO:0015711, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0005452 [MF]inorganic anion exchanger activityprobableGO:0022891, GO:0015297, GO:0022892, GO:0015291, GO:0015301, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0022804
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0015226 [MF]carnitine transmembrane transporter activityprobableGO:0022891, GO:0003674, GO:0022892, GO:0015651, GO:0008028, GO:0005215, GO:0008509, GO:0008324, GO:0022857, GO:0015075, GO:0008514, GO:1901618, GO:0015101, GO:0015199, GO:0005342, GO:0015171, GO:0046943
GO:0015695 [BP]organic cation transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0015697 [BP]quaternary ammonium group transportprobableGO:0006810, GO:0071705, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0034220 [BP]ion transmembrane transportprobableGO:0009987, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0044763, GO:0008150, GO:0051234, GO:0055085, GO:0044699
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GC0, chain A
Confidence level:confident
Coverage over the Query: 9-171
View the alignment between query and template
View the model in PyMOL
Template: 4GBY, chain A
Confidence level:probable
Coverage over the Query: 5-194
View the alignment between query and template
View the model in PyMOL