Diaphorina citri psyllid: psy2970

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33

MFVLLNRILDWFKSLFWKEEMELTLVGLQCSGKTTFVNVIASGQFSQDMIPTVGFNMRKITKGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVWTGGLYIVSKHIKRSAILYYEPVDLGVSGPMWLSLLFQLIKYMVDAADTDKLEASRNELHALIEKPQLIGIPILVLGNKRDLPNALDEKELIDRIMIDFWITLTLLIRWCESFLHHFGSHPNWAVKWHTLPKLLFLSLVDSYVSSGASDYTEEAGCTISILMLSWYSVTVRQHWSYIIMYIVHKPLAYRLECNMSRVSTTTHSSCTYFSPFQNHKVLCNQMHHLTLKTRHIGANYE

cHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHcccccCCcccccccEEEEEEEccEEEEEEEEcccccccHHHHHHcccccEEEEEcccccccccccccccccccccccccccccHHHHHHccEEEEcccccccHHHHHHHHHHHcccccccccccEEEEECcccccccccHHHHHHHccccccccccEEEEEEccccccccccHHHHHHccccHHHHHccccccccccccccccccccccHHEHHHHEEEEEEEccccEEEEEEEcccccHHHHccccccccCECcccCCcccccccHHHHcccccEEEEECccccccc

*FVLLNRILDWFKSLFWKEEMELTLVGLQCSGKTTFVNVIASGQFSQDMIPTVGFNMRKITKGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVWTGGLYIVSKHIKRSAILYYEPVDLGVSGPMWLSLLFQLIKYMVDAADTDKLEASRNELHALIEKPQLIGIPILVLGNKRDLPNALDEKELIDRIMIDFWITLTLLIRWCESFLHHFGSHPNWAVKWHTLPKLLFLSLVDSYVSSGASDYTEEAGCTISILMLSWYSVTVRQHWSYIIMYIVHKPLAYRLECNMSRVSTTTHSSCTYFSPFQNHKVLCNQMHHLTLKTRHI*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ADP-ribosylation factor-like protein 8	May play a role in lysosome motility (PubMed:16537643). Essential role in chromosome segregation (PubMed:15331635).	confident	Q9VHV5
ADP-ribosylation factor-like protein 8		confident	Q54R04
ADP-ribosylation factor-like protein 8B	May play a role in lysosomes motility. Alternatively, may play a role in chromosome segregation.	confident	Q5R6E7

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005773 [CC]	vacuole	confident	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0044446 [CC]	intracellular organelle part	confident	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0019003 [MF]	GDP binding	probable	GO:0043168, GO:0017076, GO:0019001, GO:0097159, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032561, GO:0003674, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043014 [MF]	alpha-tubulin binding	probable	GO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0048786 [CC]	presynaptic active zone	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:0009506 [CC]	plasmodesma	probable	GO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0005525 [MF]	GTP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030496 [CC]	midbody	probable	GO:0005575, GO:0044464, GO:0005623
GO:0008021 [CC]	synaptic vesicle	probable	GO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0051607 [BP]	defense response to virus	probable	GO:0002376, GO:0009607, GO:0009615, GO:0050896, GO:0006952, GO:0006950, GO:0008150, GO:0002252, GO:0051707, GO:0051704
GO:0051233 [CC]	spindle midzone	probable	GO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0048487 [MF]	beta-tubulin binding	probable	GO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0003924 [MF]	GTPase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0065008 [BP]	regulation of biological quality	probable	GO:0008150, GO:0065007
GO:0044425 [CC]	membrane part	probable	GO:0005575, GO:0016020
GO:0006886 [BP]	intracellular protein transport	probable	GO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006810, GO:0045184, GO:0008104, GO:0044763, GO:0044699, GO:0071702, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0051649, GO:0051641
GO:0008340 [BP]	determination of adult lifespan	probable	GO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0044463 [CC]	cell projection part	probable	GO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0051301 [BP]	cell division	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0005765 [CC]	lysosomal membrane	probable	GO:0005737, GO:0044446, GO:0000323, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0005764, GO:0044444, GO:0044437, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0008333 [BP]	endosome to lysosome transport	probable	GO:0016197, GO:0051234, GO:0046907, GO:0007034, GO:0006810, GO:0044765, GO:0008150, GO:0007041, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0044431 [CC]	Golgi apparatus part	probable	GO:0005737, GO:0005794, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0007264 [BP]	small GTPase mediated signal transduction	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0031902 [CC]	late endosome membrane	probable	GO:0005737, GO:0005575, GO:0005770, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0043226, GO:0044422, GO:0010008
GO:0016192 [BP]	vesicle-mediated transport	probable	GO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0006184 [BP]	GTP catabolic process	probable	GO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0000819 [BP]	sister chromatid segregation	probable	GO:0006996, GO:0051276, GO:0022402, GO:0009987, GO:0016043, GO:0008150, GO:0044763, GO:0044699, GO:0071840, GO:0007059, GO:0007049
GO:0007067 [BP]	mitosis	probable	GO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007049
GO:0051130 [BP]	positive regulation of cellular component organization	probable	GO:0051128, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0044087 [BP]	regulation of cellular component biogenesis	probable	GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0044249 [BP]	cellular biosynthetic process	probable	GO:0009058, GO:0009987, GO:0008150, GO:0008152, GO:0044237

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZD9, chain A
Confidence level:very confident
Coverage over the Query: 17-93,135-211
View the alignment between query and template
View the model in PyMOL

Template: 2HF9, chain A
Confidence level:confident
Coverage over the Query: 18-101,122-211
View the alignment between query and template
View the model in PyMOL