Diaphorina citri psyllid: psy2976


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
FSDDISSNTSSSSPDTTSHHHRHKHPQHQLNTTIPPSPSTIVVSQTSLPEAYTVHHRDTRAATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIRENIM
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEccccccccEEEEEccccccECccccccccCEEEEccccccccHHHHHHHHHHHccccccccccccccEEEcccccc
***********************************PSPSTIVVS******************TARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIRENIM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FSDDISSNTSSSSPDTTSHHHRHKHPQHQLNTTIPPSPSTIVVSQTSLPEAYTVHHRDTRAATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIRENIM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tolloid-like protein 1 Protease which processes procollagen C-propeptides, such as chordin, probiglycan and prolysyl oxidase. Required for the embryonic development. Predominant protease, which in the development, influences dorsal-ventral patterning and skeletogenesis.confidentQ9DER7
Tolloid-like protein 1 Protease which processes procollagen C-propeptides, such as chordin, pro-biglycan and pro-lysyl oxidase. Required for the embryonic development, especially heart development. Predominant protease, which in the development, influences dorsal-ventral patterning and skeletogenesis.confidentQ62381
Dorsal-ventral patterning tolloid-like protein 1 Required for patterning ventral tissues of the tail. May increase bone morphogenetic protein (BMP) activity at the end of gastrulation by proteolytic cleavage of chordin and release of BMP from inactive complexes.confidentO57460

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005518 [MF]collagen bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0016485 [BP]protein processingprobableGO:0044238, GO:0051604, GO:0019538, GO:0043170, GO:0071704, GO:0010467, GO:0008150, GO:0008152
GO:0010629 [BP]negative regulation of gene expressionprobableGO:0009892, GO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0048519, GO:0010605, GO:0010468
GO:0001501 [BP]skeletal system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0001503 [BP]ossificationprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0048264 [BP]determination of ventral identityprobableGO:0032502, GO:0007389, GO:0032501, GO:0009953, GO:0044707, GO:0009799, GO:0008150, GO:0003002, GO:0009855, GO:0048262, GO:0007275, GO:0044699
GO:0017015 [BP]regulation of transforming growth factor beta receptor signaling pathwayprobableGO:0090092, GO:0009966, GO:0048583, GO:0090287, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0007362 [BP]terminal region determinationprobableGO:0032502, GO:0007389, GO:0032501, GO:0009880, GO:0044707, GO:0009790, GO:0009948, GO:0048856, GO:0044767, GO:0008595, GO:0009952, GO:0008150, GO:0003002, GO:0000578, GO:0035282, GO:0009798, GO:0007351, GO:0007350, GO:0007275, GO:0044699, GO:0007354
GO:0004222 [MF]metalloendopeptidase activityprobableGO:0016787, GO:0004175, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008237
GO:0009888 [BP]tissue developmentprobableGO:0032502, GO:0048856, GO:0008150
GO:0007313 [BP]maternal specification of dorsal/ventral axis, oocyte, soma encodedprobableGO:0048610, GO:0009994, GO:0007310, GO:0048468, GO:0007569, GO:0007292, GO:0032501, GO:0007309, GO:0007308, GO:0009798, GO:0010259, GO:0007275, GO:0044699, GO:0007389, GO:0000003, GO:0003006, GO:0048869, GO:0007276, GO:0048477, GO:0032502, GO:0048599, GO:0030154, GO:0048609, GO:0032504, GO:0009987, GO:0019953, GO:0007281, GO:0022414, GO:0008150, GO:0003002, GO:0022412, GO:0044767, GO:0044702, GO:0009953, GO:0044707, GO:0009950, GO:0048856, GO:0044763
GO:0008045 [BP]motor neuron axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0008293 [BP]torso signaling pathwayprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0010468, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0044763, GO:0051171, GO:2001141, GO:0007154, GO:0044700, GO:0050896, GO:0051252, GO:0006355, GO:0010556, GO:0008150
GO:0016020 [CC]membraneprobableGO:0005575
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0008586 [BP]imaginal disc-derived wing vein morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0030513 [BP]positive regulation of BMP signaling pathwayprobableGO:0090092, GO:0010646, GO:0090100, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0048522, GO:0050789, GO:0030510
GO:0031988 [CC]membrane-bounded vesicleprobableGO:0005575, GO:0031982, GO:0043226
GO:0030198 [BP]extracellular matrix organizationprobableGO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0043062, GO:0008150, GO:0071840
GO:0033333 [BP]fin developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0044699, GO:0007275, GO:0048736
GO:0061036 [BP]positive regulation of cartilage developmentprobableGO:0051094, GO:0050793, GO:0008150, GO:0061035, GO:2000026, GO:0051239, GO:0048518, GO:0065007, GO:0050789
GO:0007415 [BP]defasciculation of motor neuron axonprobableGO:0008037, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007414, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0008038, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0044707, GO:0048856, GO:0007399, GO:0032502, GO:0048812, GO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EDH, chain A
Confidence level:very confident
Coverage over the Query: 62-184
View the alignment between query and template
View the model in PyMOL