Psyllid ID: psy2976

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
FSDDISSNTSSSSPDTTSHHHRHKHPQHQLNTTIPPSPSTIVVSQTSLPEAYTVHHRDTRAATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIRENIM
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEccccccccEEEEEccccccEEccccccccEEEEEccccccccHHHHHHHHHHHccccccccccccccEEEcccccc
ccccccHccccccccccccccccccccccccccccHHHccHccccccccccccccccccHHHcccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHccEEEEEEccccccccEEEEEEcccccEcEEcccccccEEEEccccccccHHHHHHHHHHHcEccHHHcccHHHcEEEcHHHEc
fsddissntsssspdttshhhrhkhpqhqlnttippspstivvsqtslpeaytvhhrdtRAATARKEriwdygvipyeidsnfggqHKALFKQAMRHWENFTCVKFversstehpnyilftekpcgccsfvgkrgngqqaisigkncdkFGIVVHELGHVVgfwhehtrpdrdnHVQIIRENIM
fsddissntsssspdttshhhrhkhpqhqlnttippsPSTIVVSQTslpeaytvhhrdtraatarkeriwDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHVVGfwhehtrpdrdnhVQIIRENIM
FsddissntsssspdttshhhrhkhpqhQLNTTIPPSPSTIVVSQTSLPEAYTVHHRDTRAATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIRENIM
**************************************************AYTVHHRDTRAATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHVVGFWHEHT****************
***********************************PSPSTIVVS******************TARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIRENIM
*******************************TTIPPSPSTIVVSQTSLPEAYTVHHRDTRAATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIRENIM
*****************************LNTTIPPSPSTIVVSQTSLP***************RKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIRENIM
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FSDDISSNTSSSSPDTTSHHHRHKHPQHQLNTTIPPSPSTIVVSQTSLPEAYTVHHRDTRAATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIRENIM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query184 2.2.26 [Sep-21-2011]
Q9DER7 1008 Tolloid-like protein 1 OS yes N/A 0.684 0.125 0.742 3e-53
O43897 1013 Tolloid-like protein 1 OS no N/A 0.684 0.124 0.75 4e-53
Q62381 1013 Tolloid-like protein 1 OS yes N/A 0.684 0.124 0.75 8e-53
Q9Y6L7 1015 Tolloid-like protein 2 OS no N/A 0.929 0.168 0.580 2e-52
P25723 1067 Dorsal-ventral patterning no N/A 0.701 0.120 0.705 2e-52
Q8JI28 1007 Tolloid-like protein 1 OS N/A N/A 0.679 0.124 0.740 3e-52
O57382 1019 Tolloid-like protein 2 OS N/A N/A 0.961 0.173 0.559 4e-52
O57460 1022 Dorsal-ventral patterning yes N/A 0.777 0.139 0.648 2e-51
Q9WVM6 1012 Tolloid-like protein 2 OS no N/A 0.907 0.165 0.587 7e-51
P98069 639 Bone morphogenetic protei yes N/A 0.695 0.200 0.669 2e-50
>sp|Q9DER7|TLL1_CHICK Tolloid-like protein 1 OS=Gallus gallus GN=TLL1 PE=2 SV=1 Back     alignment and function desciption
 Score =  207 bits (527), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 108/128 (84%), Gaps = 2/128 (1%)

Query: 56  HRDTRAATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHP 115
           +R  RAAT+R ERIW  GVIPY I  NF G  +A+FKQAMRHWE +TCV F+ERS  E  
Sbjct: 139 NRFPRAATSRTERIWPGGVIPYVIGGNFTGTQRAMFKQAMRHWEKYTCVTFIERSDEE-- 196

Query: 116 NYILFTEKPCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNH 175
           +YI+FT +PCGCCS+VG+RGNG QAISIGKNCDKFGIVVHELGHV+GFWHEHTRPDRD+H
Sbjct: 197 SYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDH 256

Query: 176 VQIIRENI 183
           V IIRENI
Sbjct: 257 VTIIRENI 264
Protease which processes procollagen C-propeptides, such as chordin, probiglycan and prolysyl oxidase. Required for the embryonic development. Predominant protease, which in the development, influences dorsal-ventral patterning and skeletogenesis.
Gallus gallus (taxid: 9031)
EC: 3EC: .EC: 4EC: .EC: 2EC: 4EC: .EC: -
>sp|O43897|TLL1_HUMAN Tolloid-like protein 1 OS=Homo sapiens GN=TLL1 PE=1 SV=1 Back     alignment and function description
>sp|Q62381|TLL1_MOUSE Tolloid-like protein 1 OS=Mus musculus GN=Tll1 PE=1 SV=1 Back     alignment and function description
>sp|Q9Y6L7|TLL2_HUMAN Tolloid-like protein 2 OS=Homo sapiens GN=TLL2 PE=1 SV=1 Back     alignment and function description
>sp|P25723|TLD_DROME Dorsal-ventral patterning protein tolloid OS=Drosophila melanogaster GN=tld PE=2 SV=2 Back     alignment and function description
>sp|Q8JI28|TLL1_XENLA Tolloid-like protein 1 OS=Xenopus laevis GN=tll1 PE=1 SV=1 Back     alignment and function description
>sp|O57382|TLL2_XENLA Tolloid-like protein 2 OS=Xenopus laevis GN=tll2 PE=2 SV=1 Back     alignment and function description
>sp|O57460|TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio GN=tll1 PE=2 SV=1 Back     alignment and function description
>sp|Q9WVM6|TLL2_MOUSE Tolloid-like protein 2 OS=Mus musculus GN=Tll2 PE=1 SV=1 Back     alignment and function description
>sp|P98069|BMPH_STRPU Bone morphogenetic protein 1 homolog OS=Strongylocentrotus purpuratus PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
91091526 1080 PREDICTED: similar to bone morphogenetic 0.706 0.120 0.892 2e-66
242023390 914 conserved hypothetical protein [Pediculu 0.820 0.165 0.734 6e-66
383851625 1225 PREDICTED: tolloid-like protein 2-like [ 0.695 0.104 0.898 1e-65
340722615 1233 PREDICTED: tolloid-like protein 2-like [ 0.695 0.103 0.890 3e-65
350424355 1086 PREDICTED: tolloid-like protein 2-like [ 0.695 0.117 0.890 4e-65
332021857 1224 Tolloid-like protein 2 [Acromyrmex echin 0.695 0.104 0.890 5e-65
157135134 1404 bone morphogenetic protein [Aedes aegypt 0.771 0.101 0.797 8e-65
170053250 1451 ubiquitin-protein ligase [Culex quinquef 0.896 0.113 0.674 3e-64
170050901 1148 dorsal-ventral patterning protein tolloi 0.706 0.113 0.830 2e-63
347970430 1532 AGAP003702-PA [Anopheles gambiae str. PE 0.880 0.105 0.693 2e-63
>gi|91091526|ref|XP_970162.1| PREDICTED: similar to bone morphogenetic protein [Tribolium castaneum] gi|270001271|gb|EEZ97718.1| hypothetical protein TcasGA2_TC011197 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 120/130 (92%)

Query: 55  HHRDTRAATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEH 114
           H R TRAATARKER+WDYGVIPYEID NF G HKALFKQAMRHWENFTCVKFVER+  EH
Sbjct: 197 HRRVTRAATARKERVWDYGVIPYEIDGNFSGGHKALFKQAMRHWENFTCVKFVERNRDEH 256

Query: 115 PNYILFTEKPCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDN 174
           PNYI+FTE+PCGCCSFVGKRGNG QAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRD 
Sbjct: 257 PNYIVFTERPCGCCSFVGKRGNGGQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDK 316

Query: 175 HVQIIRENIM 184
           HV IIRENIM
Sbjct: 317 HVNIIRENIM 326

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242023390|ref|XP_002432117.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212517491|gb|EEB19379.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|383851625|ref|XP_003701332.1| PREDICTED: tolloid-like protein 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340722615|ref|XP_003399699.1| PREDICTED: tolloid-like protein 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350424355|ref|XP_003493768.1| PREDICTED: tolloid-like protein 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332021857|gb|EGI62193.1| Tolloid-like protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|157135134|ref|XP_001663414.1| bone morphogenetic protein [Aedes aegypti] gi|108870300|gb|EAT34525.1| AAEL013239-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170053250|ref|XP_001862587.1| ubiquitin-protein ligase [Culex quinquefasciatus] gi|167873842|gb|EDS37225.1| ubiquitin-protein ligase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|170050901|ref|XP_001861521.1| dorsal-ventral patterning protein tolloid [Culex quinquefasciatus] gi|167872398|gb|EDS35781.1| dorsal-ventral patterning protein tolloid [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|347970430|ref|XP_313494.5| AGAP003702-PA [Anopheles gambiae str. PEST] gi|333468930|gb|EAA08933.5| AGAP003702-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
FB|FBgn0004885 1464 tok "tolkin" [Drosophila melan 0.777 0.097 0.736 1.2e-55
UNIPROTKB|F1Q3H3 969 TLL1 "Uncharacterized protein" 0.684 0.130 0.75 1.8e-50
UNIPROTKB|O43897 1013 TLL1 "Tolloid-like protein 1" 0.684 0.124 0.75 2.1e-50
UNIPROTKB|E9PD25 1036 TLL1 "Tolloid-like protein 1" 0.684 0.121 0.75 2.3e-50
UNIPROTKB|Q9DER7 1008 TLL1 "Tolloid-like protein 1" 0.684 0.125 0.742 3.4e-50
UNIPROTKB|F1P398 1009 TLL1 "Tolloid-like protein 1" 0.684 0.124 0.742 3.4e-50
RGD|1306120 955 Tll1 "tolloid-like 1" [Rattus 0.684 0.131 0.75 3.6e-50
MGI|MGI:106923 1013 Tll1 "tolloid-like" [Mus muscu 0.684 0.124 0.75 4.5e-50
UNIPROTKB|Q3MIM8302 BMP1 "Bone morphogenetic prote 0.820 0.5 0.627 5.8e-50
UNIPROTKB|F1N0X6 1013 TLL1 "Uncharacterized protein" 0.684 0.124 0.734 7.4e-50
FB|FBgn0004885 tok "tolkin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 586 (211.3 bits), Expect = 1.2e-55, P = 1.2e-55
 Identities = 106/144 (73%), Positives = 117/144 (81%)

Query:    41 IVVSQTSLPEAYTVHHRDTRAATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWEN 100
             ++ ++TS  E   + HR  RA TA+KERIWDYGVIPYEID NF G HKALFK AMRHWEN
Sbjct:   501 LLKAETSKDEE-PLRHRVARAVTAKKERIWDYGVIPYEIDGNFSGIHKALFKLAMRHWEN 559

Query:   101 FTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHV 160
              TC+KFVER    HPNYI+FT + CGCCSFVGKRGNG QAISIG+NCDKFGIVVHELGHV
Sbjct:   560 STCIKFVERDPEIHPNYIVFTVRSCGCCSFVGKRGNGPQAISIGRNCDKFGIVVHELGHV 619

Query:   161 VGFWHEHTRPDRDNHVQIIRENIM 184
             VGFWHEHTRPDR+ HV I   NIM
Sbjct:   620 VGFWHEHTRPDREKHVVIEHNNIM 643
GO:0004222 "metalloendopeptidase activity" evidence=ISS
GO:0005509 "calcium ion binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0008586 "imaginal disc-derived wing vein morphogenesis" evidence=IMP
GO:0008045 "motor neuron axon guidance" evidence=IMP
GO:0007415 "defasciculation of motor neuron axon" evidence=IMP
GO:0010629 "negative regulation of gene expression" evidence=IDA
GO:0016485 "protein processing" evidence=IDA
GO:0007411 "axon guidance" evidence=IMP
UNIPROTKB|F1Q3H3 TLL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O43897 TLL1 "Tolloid-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PD25 TLL1 "Tolloid-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9DER7 TLL1 "Tolloid-like protein 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P398 TLL1 "Tolloid-like protein 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1306120 Tll1 "tolloid-like 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:106923 Tll1 "tolloid-like" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q3MIM8 BMP1 "Bone morphogenetic protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N0X6 TLL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q20176NAS39_CAEEL3, ., 4, ., 2, 4, ., 2, 10.63010.78800.1524yesN/A
O57460TLL1_DANRE3, ., 4, ., 2, 4, ., -0.64820.77710.1399yesN/A
Q9DER7TLL1_CHICK3, ., 4, ., 2, 4, ., -0.74210.68470.125yesN/A
Q62381TLL1_MOUSE3, ., 4, ., 2, 4, ., -0.750.68470.1243yesN/A
P98069BMPH_STRPU3, ., 4, ., 2, 4, ., -0.66920.69560.2003yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.240.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
cd04281200 cd04281, ZnMc_BMP1_TLD, Zinc-dependent metalloprot 8e-88
pfam01400191 pfam01400, Astacin, Astacin (Peptidase family M12A 6e-65
cd04280180 cd04280, ZnMc_astacin_like, Zinc-dependent metallo 2e-51
smart00235139 smart00235, ZnMc, Zinc-dependent metalloprotease 6e-40
cd04283182 cd04283, ZnMc_hatching_enzyme, Zinc-dependent meta 2e-30
cd04282230 cd04282, ZnMc_meprin, Zinc-dependent metalloprotea 8e-23
cd00203167 cd00203, ZnMc, Zinc-dependent metalloprotease 6e-21
cd04268165 cd04268, ZnMc_MMP_like, Zinc-dependent metalloprot 1e-17
cd04279156 cd04279, ZnMc_MMP_like_1, Zinc-dependent metallopr 4e-06
>gnl|CDD|239808 cd04281, ZnMc_BMP1_TLD, Zinc-dependent metalloprotease; BMP1/TLD-like subfamily Back     alignment and domain information 
 Score =  255 bits (654), Expect = 8e-88
 Identities = 99/124 (79%), Positives = 107/124 (86%), Gaps = 2/124 (1%)

Query: 61  AATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILF 120
           AATARKERIW  GVIPY ID NF G  +A+FKQAMRHWENFTCV FVER  T   NYI+F
Sbjct: 1   AATARKERIWPGGVIPYVIDGNFTGSQRAMFKQAMRHWENFTCVTFVER--TPEENYIVF 58

Query: 121 TEKPCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIR 180
           T +PCGCCS+VG+RGNG QAISIGKNCDKFGIVVHELGHV+GFWHEHTRPDRD+HV IIR
Sbjct: 59  TYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIR 118

Query: 181 ENIM 184
           ENI 
Sbjct: 119 ENIQ 122

BMP1 (Bone morphogenetic protein 1) and TLD (tolloid)-like metalloproteases play vital roles in extracellular matrix formation, by cleaving precursor proteins such as enzymes, structural proteins, and proteins involved in the mineralization of the extracellular matrix. The drosophila protein tolloid and its Xenopus homologue xolloid cleave and inactivate Sog and chordin, respectively, which are inhibitors of Dpp (the Drosophila decapentaplegic gene product) and its homologue BMP4, involved in dorso-ventral patterning. Length = 200
>gnl|CDD|201773 pfam01400, Astacin, Astacin (Peptidase family M12A) Back     alignment and domain information
>gnl|CDD|239807 cd04280, ZnMc_astacin_like, Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site Back     alignment and domain information
>gnl|CDD|214576 smart00235, ZnMc, Zinc-dependent metalloprotease Back     alignment and domain information
>gnl|CDD|239810 cd04283, ZnMc_hatching_enzyme, Zinc-dependent metalloprotease, hatching enzyme-like subfamily Back     alignment and domain information
>gnl|CDD|239809 cd04282, ZnMc_meprin, Zinc-dependent metalloprotease, meprin_like subfamily Back     alignment and domain information
>gnl|CDD|238124 cd00203, ZnMc, Zinc-dependent metalloprotease Back     alignment and domain information
>gnl|CDD|239796 cd04268, ZnMc_MMP_like, Zinc-dependent metalloprotease, MMP_like subfamily Back     alignment and domain information
>gnl|CDD|239806 cd04279, ZnMc_MMP_like_1, Zinc-dependent metalloprotease; MMP_like sub-family 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 184
cd04281200 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1 100.0
cd04282230 ZnMc_meprin Zinc-dependent metalloprotease, meprin 100.0
) family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01400">PF01400191 Astacin: Astacin (Peptidase family M12A) This Pros 100.0
cd04283182 ZnMc_hatching_enzyme Zinc-dependent metalloproteas 100.0
KOG3714|consensus 411 100.0
cd04280180 ZnMc_astacin_like Zinc-dependent metalloprotease, 100.0
smart00235140 ZnMc Zinc-dependent metalloprotease. Neutral zinc 100.0
cd04327198 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MM 99.97
cd04268165 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_ 99.91
cd04278157 ZnMc_MMP Zinc-dependent metalloprotease, matrix me 99.79
cd00203167 ZnMc Zinc-dependent metalloprotease. This super-fa 99.7
cd04279156 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MM 99.61
PF00413154 Peptidase_M10: Matrixin This Prosite motif covers 99.57
cd04277186 ZnMc_serralysin_like Zinc-dependent metalloproteas 99.56
KOG1565|consensus 469 98.91
PF12388211 Peptidase_M57: Dual-action HEIGH metallo-peptidase 98.8
cd04276197 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MM 98.58
PF02031132 Peptidase_M7: Streptomyces extracellular neutral p 98.29
COG5549236 Predicted Zn-dependent protease [Posttranslational 97.3
PF13583206 Reprolysin_4: Metallo-peptidase family M12B Reprol 96.74
PF13582124 Reprolysin_3: Metallo-peptidase family M12B Reprol 96.74
cd04267192 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADA 96.56
PF05572154 Peptidase_M43: Pregnancy-associated plasma protein 96.47
PF13688196 Reprolysin_5: Metallo-peptidase family M12; PDB: 2 96.19
PF05548 314 Peptidase_M11: Gametolysin peptidase M11; InterPro 96.07
PF13574173 Reprolysin_2: Metallo-peptidase family M12B Reprol 96.02
cd04272220 ZnMc_salivary_gland_MPs Zinc-dependent metalloprot 95.85
cd04269194 ZnMc_adamalysin_II_like Zinc-dependent metalloprot 95.73
cd04270244 ZnMc_TACE_like Zinc-dependent metalloprotease; TAC 95.29
cd04275225 ZnMc_pappalysin_like Zinc-dependent metalloproteas 95.26
cd04271228 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, A 95.19
cd04273207 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, A 95.13
COG1913181 Predicted Zn-dependent proteases [General function 95.09
PF01421199 Reprolysin: Reprolysin (M12B) family zinc metallop 95.06
PRK13267179 archaemetzincin-like protein; Reviewed 94.71
PF07998194 Peptidase_M54: Peptidase family M54; InterPro: IPR 94.44
PF11350203 DUF3152: Protein of unknown function (DUF3152); In 94.29
TIGR03296286 M6dom_TIGR03296 M6 family metalloprotease domain. 93.48
PF12044423 Metallopep: Putative peptidase family; InterPro: I 93.08
PF10462305 Peptidase_M66: Peptidase M66; InterPro: IPR019503 92.68
PF01457 521 Peptidase_M8: Leishmanolysin This Prosite motif co 92.43
cd06459 427 M3B_Oligoendopeptidase_F Peptidase family M3B Olig 91.72
PTZ00337 567 surface protease GP63; Provisional 91.5
TIGR00181 591 pepF oligoendopeptidase F. This family represents 91.45
cd0264160 R3H_Smubp-2_like R3H domain of Smubp-2_like protei 91.11
TIGR02290 587 M3_fam_3 oligoendopeptidase, pepF/M3 family. The M 90.72
PTZ00257 622 Glycoprotein GP63 (leishmanolysin); Provisional 90.33
TIGR02289 549 M3_not_pepF oligoendopeptidase, M3 family. This fa 88.86
KOG4525|consensus 614 88.58
PF12725318 DUF3810: Protein of unknown function (DUF3810); In 87.87
PF05547 645 Peptidase_M6: Immune inhibitor A peptidase M6; Int 87.12
cd0600759 R3H_DEXH_helicase R3H domain of a group of protein 86.33
KOG3607|consensus 716 85.89
cd0264060 R3H_NRF R3H domain of the NF-kappaB-repression fac 85.42
PF09471264 Peptidase_M64: IgA Peptidase M64; InterPro: IPR019 82.66
PF04298222 Zn_peptidase_2: Putative neutral zinc metallopepti 80.33
cd0264263 R3H_encore_like R3H domain of encore-like and DIP1 80.05
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily Back     alignment and domain information 
Probab=100.00  E-value=3e-45  Score=297.95  Aligned_cols=121  Identities=80%  Similarity=1.446  Sum_probs=112.4

Q ss_pred             cccCCCCCcCCCceEEEEcCCCCHHHHHHHHHHHHHhhcccceEEEEcCCCCCCcEEEEecCCCCcccccCCCCCCccee
Q psy2976          62 ATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQAI  141 (184)
Q Consensus        62 a~~~~~~~Wp~g~IpY~~~~~~~~~~r~~I~~A~~~we~~TcV~F~e~~~~~~~~~I~f~~~~~gC~S~vG~~~~g~q~i  141 (184)
                      |......+||+++|||.|+++|+...+..|++||++|++.|||+|+|++.  +.+||.|...+.||||+||+.+.|.|.|
T Consensus         2 ~~~~~~~~Wp~~~VpY~i~~~~~~~~~~~I~~Am~~~~~~TCirF~~r~~--~~~yi~f~~~~~GC~S~vG~~~~g~q~i   79 (200)
T cd04281           2 ATARKERIWPGGVIPYVIDGNFTGSQRAMFKQAMRHWENFTCVTFVERTP--EENYIVFTYRPCGCCSYVGRRGNGPQAI   79 (200)
T ss_pred             CccCccCcCCCCEEEEEECCCCCHHHHHHHHHHHHHHHhCCceEEEECCC--CCCEEEEEECCCCeeEcCCCcCCCceee
Confidence            34456789999999999999999999999999999999999999999987  5799999865679999999988789999


Q ss_pred             ecCCCCchHHHHHHHHHHhhCCCCCCCCCCCCCceEeecccCC
Q psy2976         142 SIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIRENIM  184 (184)
Q Consensus       142 sl~~~c~~~g~i~HElgHALG~~HEh~RpDRD~yV~I~~~NI~  184 (184)
                      +|+.+|...|+|+|||||||||+|||+|||||+||+|+|+||+
T Consensus        80 sl~~~C~~~Gti~HEl~HaLGf~HEhsRpDRD~yV~I~~~nI~  122 (200)
T cd04281          80 SIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRENIQ  122 (200)
T ss_pred             ecCCCcCcCchHHHHHHHHhcCcchhccccccceEEEeecccC
Confidence            9999999999999999999999999999999999999999995

BMP1 (Bone morphogenetic protein 1) and TLD (tolloid)-like metalloproteases play vital roles in extracellular matrix formation, by cleaving precursor proteins such as enzymes, structural proteins, and proteins involved in the mineralization of the extracellular matrix. The drosophila protein tolloid and its Xenopus homologue xolloid cleave and inactivate Sog and chordin, respectively, which are inhibitors of Dpp (the Drosophila decapentaplegic gene product) and its homologue BMP4, involved in dorso-ventral patterning.
>cd04282 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like subfamily Back     alignment and domain information
>PF01400 Astacin: Astacin (Peptidase family M12A) This Prosite motif covers only the active site Back     alignment and domain information
>cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily Back     alignment and domain information
>KOG3714|consensus Back     alignment and domain information
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site Back     alignment and domain information
>smart00235 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3 Back     alignment and domain information
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily Back     alignment and domain information
>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family Back     alignment and domain information
>cd00203 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1 Back     alignment and domain information
>PF00413 Peptidase_M10: Matrixin This Prosite motif covers only the active site Back     alignment and domain information
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily Back     alignment and domain information
>KOG1565|consensus Back     alignment and domain information
>PF12388 Peptidase_M57: Dual-action HEIGH metallo-peptidase; InterPro: IPR024653 This entry represents the metallopeptidases M10, M27 and M57 Back     alignment and domain information
>cd04276 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_like sub-family 2 Back     alignment and domain information
>PF02031 Peptidase_M7: Streptomyces extracellular neutral proteinase (M7) family; InterPro: IPR000013 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG5549 Predicted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13583 Reprolysin_4: Metallo-peptidase family M12B Reprolysin-like Back     alignment and domain information
>PF13582 Reprolysin_3: Metallo-peptidase family M12B Reprolysin-like; PDB: 3P24_C Back     alignment and domain information
>cd04267 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup Back     alignment and domain information
>PF05572 Peptidase_M43: Pregnancy-associated plasma protein-A; InterPro: IPR008754 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13688 Reprolysin_5: Metallo-peptidase family M12; PDB: 2FV5_B 3EWJ_A 3KME_A 3L0T_B 1BKC_E 3G42_D 2I47_D 2FV9_B 3LEA_A 1ZXC_B Back     alignment and domain information
>PF05548 Peptidase_M11: Gametolysin peptidase M11; InterPro: IPR008752 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13574 Reprolysin_2: Metallo-peptidase family M12B Reprolysin-like; PDB: 1KAP_P 1JIW_P 1AKL_A 1OM7_A 1OM8_A 1O0T_A 1OM6_A 1H71_P 1O0Q_A 1OMJ_A Back     alignment and domain information
>cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs Back     alignment and domain information
>cd04269 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; adamalysin_II_like subfamily Back     alignment and domain information
>cd04270 ZnMc_TACE_like Zinc-dependent metalloprotease; TACE_like subfamily Back     alignment and domain information
>cd04275 ZnMc_pappalysin_like Zinc-dependent metalloprotease, pappalysin_like subfamily Back     alignment and domain information
>cd04271 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, ADAM_fungal subgroup Back     alignment and domain information
>cd04273 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, ADAMTS_like subgroup Back     alignment and domain information
>COG1913 Predicted Zn-dependent proteases [General function prediction only] Back     alignment and domain information
>PF01421 Reprolysin: Reprolysin (M12B) family zinc metalloprotease This Prosite motif covers only the active site Back     alignment and domain information
>PRK13267 archaemetzincin-like protein; Reviewed Back     alignment and domain information
>PF07998 Peptidase_M54: Peptidase family M54; InterPro: IPR012962 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF11350 DUF3152: Protein of unknown function (DUF3152); InterPro: IPR022603 This entry represents Actinobacteria proteins of unknown function Back     alignment and domain information
>TIGR03296 M6dom_TIGR03296 M6 family metalloprotease domain Back     alignment and domain information
>PF12044 Metallopep: Putative peptidase family; InterPro: IPR021917 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF10462 Peptidase_M66: Peptidase M66; InterPro: IPR019503 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF01457 Peptidase_M8: Leishmanolysin This Prosite motif covers only the active site Back     alignment and domain information
>cd06459 M3B_Oligoendopeptidase_F Peptidase family M3B Oligopeptidase F (PepF; Pz-peptidase B; EC 3 Back     alignment and domain information
>PTZ00337 surface protease GP63; Provisional Back     alignment and domain information
>TIGR00181 pepF oligoendopeptidase F Back     alignment and domain information
>cd02641 R3H_Smubp-2_like R3H domain of Smubp-2_like proteins Back     alignment and domain information
>TIGR02290 M3_fam_3 oligoendopeptidase, pepF/M3 family Back     alignment and domain information
>PTZ00257 Glycoprotein GP63 (leishmanolysin); Provisional Back     alignment and domain information
>TIGR02289 M3_not_pepF oligoendopeptidase, M3 family Back     alignment and domain information
>KOG4525|consensus Back     alignment and domain information
>PF12725 DUF3810: Protein of unknown function (DUF3810); InterPro: IPR024294 This family of bacterial proteins is functionally uncharacterised Back     alignment and domain information
>PF05547 Peptidase_M6: Immune inhibitor A peptidase M6; InterPro: IPR008757 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd06007 R3H_DEXH_helicase R3H domain of a group of proteins which also contain a DEXH-box helicase domain, and may function as ATP-dependent DNA or RNA helicases Back     alignment and domain information
>KOG3607|consensus Back     alignment and domain information
>cd02640 R3H_NRF R3H domain of the NF-kappaB-repression factor (NRF) Back     alignment and domain information
>PF09471 Peptidase_M64: IgA Peptidase M64; InterPro: IPR019026 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF04298 Zn_peptidase_2: Putative neutral zinc metallopeptidase; InterPro: IPR007395 Members of this family of bacterial proteins are described as hypothetical proteins or zinc-dependent proteases Back     alignment and domain information
>cd02642 R3H_encore_like R3H domain of encore-like and DIP1-like proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
3edi_A201 Crystal Structure Of Tolloid-Like Protease 1 (Tll-1 7e-53
3edg_A202 Crystal Structure Of Bone Morphogenetic Protein 1 P 5e-50
3edh_A201 Crystal Structure Of Bone Morphogenetic Protein 1 P 6e-50
1ast_A200 Structure Of Astacin And Implications For Activatio 4e-19
3lq0_A235 Zymogen Structure Of Crayfish Astacin Metallopeptid 3e-18
4gwm_A 592 Crystal Structure Of Human Promeprin Beta Length = 4e-16
4gwn_A 553 Crystal Structure Of Human Mature Meprin Beta Lengt 4e-16
3lqb_A199 Crystal Structure Of The Hatching Enzyme Zhe1 From 4e-13
>pdb|3EDI|A Chain A, Crystal Structure Of Tolloid-Like Protease 1 (Tll-1) Protease Domain Length = 201 Back     alignment and structure 
Iteration: 1

 Score =  202 bits (515), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 104/123 (84%), Gaps = 2/123 (1%)
Query: 61  AATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILF 120
           AAT+R ERIW  GVIPY I  NF G  +A+FKQAMRHWE  TCV F+ERS  E  +YI+F
Sbjct: 1   AATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFIERSDEE--SYIVF 58
Query: 121 TEKPCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIR 180
           T +PCGCCS+VG+RGNG QAISIGKNCDKFGIVVHELGHV+GFWHEHTRPDRDNHV IIR
Sbjct: 59  TYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIR 118
Query: 181 ENI 183
           ENI
Sbjct: 119 ENI 121
>pdb|3EDG|A Chain A, Crystal Structure Of Bone Morphogenetic Protein 1 Protease Domain Length = 202 Back     alignment and structure
>pdb|3EDH|A Chain A, Crystal Structure Of Bone Morphogenetic Protein 1 Protease Domain In Complex With Partially Bound Dmso Length = 201 Back     alignment and structure
>pdb|1AST|A Chain A, Structure Of Astacin And Implications For Activation Of Astacins And Zinc-Ligation Of Collagenases Length = 200 Back     alignment and structure
>pdb|3LQ0|A Chain A, Zymogen Structure Of Crayfish Astacin Metallopeptidase Length = 235 Back     alignment and structure
>pdb|4GWM|A Chain A, Crystal Structure Of Human Promeprin Beta Length = 592 Back     alignment and structure
>pdb|4GWN|A Chain A, Crystal Structure Of Human Mature Meprin Beta Length = 553 Back     alignment and structure
>pdb|3LQB|A Chain A, Crystal Structure Of The Hatching Enzyme Zhe1 From The Zebrafish Danio Rerio Length = 199 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
3edh_A201 Bone morphogenetic protein 1; vicinal disulfide, a 5e-59
3lq0_A235 Proastacin; metallopeptidase, zymogen activation, 1e-53
3lqb_A199 Hatching enzyme, LOC792177 protein; hydrolase, met 2e-46
830c_A168 MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 3e-04
>3edh_A Bone morphogenetic protein 1; vicinal disulfide, alternative splicing, calcium, chondrogenesis, cleavage on PAIR of basic residues, cytokine; 1.25A {Homo sapiens} PDB: 3edg_A 3edi_A Length = 201 Back     alignment and structure
 Score =  182 bits (463), Expect = 5e-59
 Identities = 88/124 (70%), Positives = 102/124 (82%), Gaps = 2/124 (1%)

Query: 61  AATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILF 120
           AAT+R ER+W  GVIP+ I  NF G  +A+F+QAMRHWE  TCV F+ER  T+  +YI+F
Sbjct: 1   AATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLER--TDEDSYIVF 58

Query: 121 TEKPCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIR 180
           T +PCGCCS+VG+RG G QAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRD HV I+R
Sbjct: 59  TYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVR 118

Query: 181 ENIM 184
           ENI 
Sbjct: 119 ENIQ 122
>3lq0_A Proastacin; metallopeptidase, zymogen activation, proenzyme, protease, Z disulfide bond, hydrolase, metal-binding, metalloprotease,; 1.45A {Astacus astacus} PDB: 1iab_A 1iaa_A 1ast_A 1iac_A 1iad_A 1iae_A 1qji_A* 1qjj_A Length = 235 Back     alignment and structure
>3lqb_A Hatching enzyme, LOC792177 protein; hydrolase, metalloprotease, astacin, metal- protease; 1.10A {Danio rerio} Length = 199 Back     alignment and structure
>830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 4a7b_A* 3tvc_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 2yig_A* 3elm_A* 3i7g_A* 3i7i_A* 3zxh_A* 2ow9_A* 2ozr_A* 3kek_A* 3kej_A* 3kec_A* 2d1n_A* 1fls_A* ... Length = 168 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
3edh_A201 Bone morphogenetic protein 1; vicinal disulfide, a 100.0
3lq0_A235 Proastacin; metallopeptidase, zymogen activation, 100.0
3lqb_A199 Hatching enzyme, LOC792177 protein; hydrolase, met 100.0
4gwm_A 592 Meprin A subunit beta; mulidomain structure, hydro 100.0
2jsd_A160 Matrix metalloproteinase-20; MMP-NNGH, structural 99.89
1hy7_A173 Stromelysin-1, MMP-3; mixed alpha beta structure, 99.86
1cge_A168 Fibroblast collagenase; hydrolase (metalloprotease 99.85
1i76_A163 MMP-8;, neutrophil collagenase; hydrolase, complex 99.83
2ovx_A159 Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) 99.82
1slm_A255 Stromelysin-1; hydrolase, metalloprotease, fibrobl 99.82
1y93_A159 Macrophage metalloelastase; matrix metalloproteina 99.81
2xs4_A167 Karilysin protease; hydrolase, bacterial MMP, viru 99.81
1hv5_A165 Stromelysin 3; inhibition, phosphinic inhibitor, h 99.8
3ayu_A167 72 kDa type IV collagenase; protease, hydrolase-hy 99.79
2y6d_A174 Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapie 99.79
1rm8_A169 MMP-16, matrix metalloproteinase-16, MT3-MMP; memb 99.74
830c_A168 MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 99.69
3ba0_A 365 Macrophage metalloelastase; FULL-length MMP-12, he 99.69
1su3_A 450 Interstitial collagenase; prodomain, hemopexin dom 99.65
1k7i_A 479 PROC, secreted protease C; metalloprotease, hydrol 99.53
1sat_A 471 Serratia protease; parallel beta helix, parallel b 99.51
3ma2_D181 Matrix metalloproteinase-14; protein - protein com 99.49
1kap_P 479 Alkaline protease; calcium binding protein, zinc m 99.49
1g9k_A 463 Serralysin; beta jelly roll, hydrolase; 1.96A {Pse 99.47
1c7k_A132 NCNP, zinc endoprotease; alpha and beta protein, m 99.08
1eak_A 421 72 kDa type IV collagenase; hydrolase-hydrolase in 99.06
1l6j_A 425 Matrix metalloproteinase-9; twisted beta sheet fla 99.03
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 99.02
2cki_A262 Ulilysin; metalloprotease, hydrolase; HET: ARG; 1. 95.97
2w15_A202 Zinc metalloproteinase BAP1; hydrolase inhibitor c 95.58
1bud_A197 Protein (acutolysin A); metalloproteinase, snake v 95.48
1qua_A197 Acutolysin-C, hemorrhagin III; metalloprotease, he 95.46
1atl_A202 Atrolysin C; metalloendopeptidase, hydrolase-hydro 95.44
1kuf_A203 Atrolysin E, metalloproteinase; alpha/beta protein 95.44
1yp1_A202 FII; FII hydrolase; 1.90A {Deinagkistrodon acutus} 95.39
3b8z_A217 Protein adamts-5; alpha/beta, hydrolase; HET: 294; 95.34
4axq_A163 Archaemetzincin; metalloprotease, protease, hydrol 95.18
2ddf_A257 ADAM 17; hydrolase; HET: INN CIT; 1.70A {Homo sapi 95.04
2v4b_A 300 Adamts-1; zymogen, protease, hydrolase, metallopro 94.89
1r55_A214 ADAM 33; metalloprotease, inhibitor, asthma, hydro 94.88
4dd8_A208 Disintegrin and metalloproteinase domain-containi 94.73
2rjp_A 316 Adamts-4; metalloprotease domain, aggrecanase, cle 94.71
2rjq_A 378 Adamts-5; metalloprotease domain, aggrecanase, cle 94.59
2i47_A288 ADAM 17; TACE-inhibitor complex, hydrolase; HET: I 94.54
3lmc_A210 Peptidase, zinc-dependent; structural genomics, PS 94.0
2ero_A 427 VAP-1, vascular apoptosis-inducing protein 1; meta 93.99
2e3x_A 427 Coagulation factor X-activating enzyme light CHAI; 93.93
2x7m_A195 Archaemetzincin; metalloprotease, protease, hydrol 93.87
2dw0_A 419 Catrocollastatin; apoptotic toxin, SVMP, metallopr 93.86
3k7n_A 397 K-like; SVMP, hydrolase; HET: NAG FUC FUL; 2.30A { 93.45
3k7l_A 422 Atragin; SVMP, metalloprotease, hydrolase; HET: NA 93.17
1lml_A 478 Leishmanolysin; metalloprotease, glycoprotein; 1.8 93.01
3g5c_A 510 ADAM 22; alpha/beta fold, cross-linked domain, cel 92.09
3p24_A397 BFT-3; metzincins, metalloendopeptidase, hydrolase 87.82
3ujz_A 869 Metalloprotease STCE; mucin-type glycoprotein, hyd 82.52
>3edh_A Bone morphogenetic protein 1; vicinal disulfide, alternative splicing, calcium, chondrogenesis, cleavage on PAIR of basic residues, cytokine; 1.25A {Homo sapiens} SCOP: d.92.1.0 PDB: 3edg_A 3edi_A Back     alignment and structure
Probab=100.00  E-value=8.8e-45  Score=294.48  Aligned_cols=121  Identities=71%  Similarity=1.352  Sum_probs=112.9

Q ss_pred             cccCCCCCcCCCceEEEEcCCCCHHHHHHHHHHHHHhhcccceEEEEcCCCCCCcEEEEecCCCCcccccCCCCCCccee
Q psy2976          62 ATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQAI  141 (184)
Q Consensus        62 a~~~~~~~Wp~g~IpY~~~~~~~~~~r~~I~~A~~~we~~TcV~F~e~~~~~~~~~I~f~~~~~gC~S~vG~~~~g~q~i  141 (184)
                      |++....+||+++|||.|+++|++.++++|++||+.|+..|||+|++++.  +.+||.|.....||||+||+.+++.|.+
T Consensus         2 ~~~~~~~~Wp~~~VpY~I~~~~s~~~~~~I~~A~~~w~~~TCIrFv~~t~--e~dyI~f~~~~~GC~S~vG~~g~~~q~~   79 (201)
T 3edh_A            2 ATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTD--EDSYIVFTYRPCGCCSYVGRRGGGPQAI   79 (201)
T ss_dssp             BBCCGGGSCGGGEEEEEECSSCCHHHHHHHHHHHHHHHHHSSCEEEECSS--CSSEEEEEECCSCSCCCSSCCCSSEEEE
T ss_pred             CcCCCCCcCCCcEEEEEECCCCCHHHHHHHHHHHHHHHhhccceEEEcCC--CCcEEEEEcCCCCCccccCCcCCceeee
Confidence            45567789999999999999999999999999999999999999999986  4789999865559999999998789999


Q ss_pred             ecCCCCchHHHHHHHHHHhhCCCCCCCCCCCCCceEeecccCC
Q psy2976         142 SIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIRENIM  184 (184)
Q Consensus       142 sl~~~c~~~g~i~HElgHALG~~HEh~RpDRD~yV~I~~~NI~  184 (184)
                      +|+.+|...|+|+|||||||||+|||+|||||+||+|+|+||+
T Consensus        80 sl~~~C~~~g~i~HEl~HalGf~HE~~R~DRD~yV~I~~~ni~  122 (201)
T 3edh_A           80 SIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQ  122 (201)
T ss_dssp             EECGGGCSHHHHHHHHHHHHTBCCGGGSTTGGGTEEECGGGBC
T ss_pred             ecCCCcCccchhHHHHHHHhcchhhhhhhccCcEEEEehhccC
Confidence            9999999999999999999999999999999999999999995
>3lq0_A Proastacin; metallopeptidase, zymogen activation, proenzyme, protease, D bond, hydrolase, metal-binding, metalloprotease, zymogen; 1.45A {Astacus astacus} PDB: 1iab_A 1iaa_A 1ast_A 1iac_A 1iad_A 1iae_A 1qji_A* 1qjj_A Back     alignment and structure
>3lqb_A Hatching enzyme, LOC792177 protein; hydrolase, metalloprotease, astacin, metal- protease; 1.10A {Danio rerio} Back     alignment and structure
>4gwm_A Meprin A subunit beta; mulidomain structure, hydrolase; HET: NAG BMA FUC MAN; 1.85A {Homo sapiens} PDB: 4gwn_A* Back     alignment and structure
>2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens} Back     alignment and structure
>1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrol; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A* 1d8f_A* 1d8m_A* 1g05_A* 1g49_A* 1c3i_A* 1sln_A* 1uea_A 2srt_A* 1ums_A* 1umt_A* 2d1o_A* 3oho_A* 1ciz_A* ... Back     alignment and structure
>1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* 3shi_A Back     alignment and structure
>1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ... Back     alignment and structure
>2ovx_A Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) type IV collagenase) (92 kDa gelatinase)...; S1-prime pocket, hydrolase-hydrola inhibitor complex; HET: 4MR; 2.00A {Homo sapiens} SCOP: d.92.1.11 PDB: 2ovz_A* 2ow0_A* 2ow1_A* 2ow2_A* 1gkd_A* 1gkc_A* Back     alignment and structure
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Back     alignment and structure
>1y93_A Macrophage metalloelastase; matrix metalloproteinase, MMP12, complex (elastase inhibitor), acetohydroxamic acid, hydrola; 1.03A {Homo sapiens} SCOP: d.92.1.11 PDB: 1rmz_A 1ycm_A* 1z3j_A* 2hu6_A* 2oxu_A 2oxw_A 2oxz_A 3lik_A* 3lil_A* 3lir_A* 3ljg_A* 1os9_A 1os2_A 3f17_A* 3ehy_A* 3ehx_A* 3f15_A* 3f16_A* 3f18_A* 3f19_A* ... Back     alignment and structure
>2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A Back     alignment and structure
>1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11 Back     alignment and structure
>3ayu_A 72 kDa type IV collagenase; protease, hydrolase-hydrolase inhibitor complex; 2.00A {Homo sapiens} PDB: 1qib_A 1hov_A* Back     alignment and structure
>2y6d_A Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapiens} PDB: 2ddy_A* 1mmq_A* 1mmp_A* 1mmr_A* 2y6c_A* Back     alignment and structure
>1rm8_A MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane type - matrix metalloproteinase, batimastat, hydroxamate inhibitor, protease, hydrolase; HET: BAT; 1.80A {Homo sapiens} SCOP: d.92.1.11 Back     alignment and structure
>830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 4a7b_A* 3tvc_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 2yig_A* 3elm_A* 3i7g_A* 3i7i_A* 3zxh_A* 2ow9_A* 2ozr_A* 3kek_A* 3kej_A* 3kec_A* 2d1n_A* 1fls_A* ... Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>1k7i_A PROC, secreted protease C; metalloprotease, hydrolase; 1.59A {Erwinia chrysanthemi} SCOP: b.80.7.1 d.92.1.6 PDB: 1k7g_A 1k7q_A 1go8_P 3hbv_P 3hda_P 3hbu_P 1go7_P 3hb2_P Back     alignment and structure
>1sat_A Serratia protease; parallel beta helix, parallel beta roll, hydrolase (serine protease); 1.75A {Serratia marcescens} SCOP: b.80.7.1 d.92.1.6 PDB: 1af0_A* 1smp_A 1srp_A Back     alignment and structure
>3ma2_D Matrix metalloproteinase-14; protein - protein complex, cleavage on PAIR of basic residue disulfide bond, membrane, metal-binding; 2.05A {Homo sapiens} SCOP: d.92.1.11 PDB: 1bqq_M 1buv_M Back     alignment and structure
>1kap_P Alkaline protease; calcium binding protein, zinc metalloprotease; 1.64A {Pseudomonas aeruginosa} SCOP: b.80.7.1 d.92.1.6 PDB: 1jiw_P 1akl_A Back     alignment and structure
>1g9k_A Serralysin; beta jelly roll, hydrolase; 1.96A {Pseudomonas} SCOP: b.80.7.1 d.92.1.6 PDB: 1o0q_A 1o0t_A 1om6_A 1om7_A 1om8_A 1omj_A 1h71_P Back     alignment and structure
>1c7k_A NCNP, zinc endoprotease; alpha and beta protein, metalloproteinase, hydrolase; 1.00A {Streptomyces caespitosus} SCOP: d.92.1.1 PDB: 1kuh_A Back     alignment and structure
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Back     alignment and structure
>2cki_A Ulilysin; metalloprotease, hydrolase; HET: ARG; 1.7A {Methanosarcina acetivorans} PDB: 2j83_A* 3lum_A* 3lun_A* Back     alignment and structure
>2w15_A Zinc metalloproteinase BAP1; hydrolase inhibitor complex, metal-binding, zinc-depending, metalloprotease, metalloproteinase/inhibitor complex; HET: WR2; 1.05A {Bothrops asper} PDB: 2w12_A* 2w13_A* 2w14_A* 1nd1_A 3gbo_A Back     alignment and structure
>1bud_A Protein (acutolysin A); metalloproteinase, snake venom, MMP, toxin; 1.90A {Deinagkistrodon acutus} SCOP: d.92.1.9 PDB: 1bsw_A Back     alignment and structure
>1qua_A Acutolysin-C, hemorrhagin III; metalloprotease, hemorrhagic toxin, snake venom proteinase; 2.20A {Deinagkistrodon acutus} SCOP: d.92.1.9 Back     alignment and structure
>1atl_A Atrolysin C; metalloendopeptidase, hydrolase-hydrolase inhibitor complex; HET: 0QI; 1.80A {Crotalus atrox} SCOP: d.92.1.9 PDB: 1htd_A 1dth_A* 3aig_A* 2aig_P* 4aig_A* 1iag_A Back     alignment and structure
>1kuf_A Atrolysin E, metalloproteinase; alpha/beta protein, hydrolase; 1.35A {Protobothrops mucrosquamatus} SCOP: d.92.1.9 PDB: 1kui_A 1kuk_A 1kug_A 1wni_A Back     alignment and structure
>1yp1_A FII; FII hydrolase; 1.90A {Deinagkistrodon acutus} Back     alignment and structure
>3b8z_A Protein adamts-5; alpha/beta, hydrolase; HET: 294; 1.40A {Homo sapiens} PDB: 3hyg_A* 3hy9_A* 3hy7_A* 3ljt_A* Back     alignment and structure
>4axq_A Archaemetzincin; metalloprotease, protease, hydrolase, metal-bindi; 1.40A {Archaeoglobus fulgidus} PDB: 2xhq_A 3zvs_A 4a3w_A* Back     alignment and structure
>2ddf_A ADAM 17; hydrolase; HET: INN CIT; 1.70A {Homo sapiens} PDB: 2fv5_A* 3l0v_A* 3kme_A* 3l0t_A* 3kmc_A* 3le9_A* 3lea_A* 3lgp_A* 3o64_A* 3ewj_A* 3edz_A* 3e8r_A* 2fv9_A* 1zxc_A* 2oi0_A* 3b92_A* 2a8h_A* 1bkc_A* 3cki_A 1bkc_I* ... Back     alignment and structure
>2v4b_A Adamts-1; zymogen, protease, hydrolase, metalloprotease, heparin-binding, metalloproteinase, metzincin, glycoprotein metal-binding; 2.00A {Homo sapiens} PDB: 2jih_A 3q2g_A* 3q2h_A* Back     alignment and structure
>1r55_A ADAM 33; metalloprotease, inhibitor, asthma, hydrolase; HET: NAG MAN 097; 1.58A {Homo sapiens} SCOP: d.92.1.9 PDB: 1r54_A* Back     alignment and structure
>4dd8_A Disintegrin and metalloproteinase domain-containi 8; batimastat, inflammation, alpha/beta motif, metalloproteinas allergic asthma, tumorigenesis; HET: BAT; 2.10A {Homo sapiens} Back     alignment and structure
>2rjp_A Adamts-4; metalloprotease domain, aggrecanase, cleavage on PAIR of basic residues, extracellular matrix, glycoprotein, hydrolase, metal-binding; HET: 886; 2.80A {Homo sapiens} PDB: 3b2z_A Back     alignment and structure
>2rjq_A Adamts-5; metalloprotease domain, aggrecanase, cleavage on PAIR of BAS residues, extracellular matrix, glycoprotein, hydrolase, ME binding; HET: NAG BAT; 2.60A {Homo sapiens} Back     alignment and structure
>2i47_A ADAM 17; TACE-inhibitor complex, hydrolase; HET: INN KGY; 1.90A {Homo sapiens} SCOP: d.92.1.10 PDB: 3g42_A* Back     alignment and structure
>3lmc_A Peptidase, zinc-dependent; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, MUR16; 2.00A {Methanocorpusculum labreanum} Back     alignment and structure
>2ero_A VAP-1, vascular apoptosis-inducing protein 1; metalloprotease, disintegrin, calcium-binding, ADAM, SVMP, M protein, toxin; HET: NAG; 2.50A {Crotalus atrox} PDB: 2erp_A* 2erq_A* Back     alignment and structure
>2e3x_A Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} Back     alignment and structure
>2x7m_A Archaemetzincin; metalloprotease, protease, hydrolase, metal-bindi; 1.50A {Methanopyrus kandleri} Back     alignment and structure
>2dw0_A Catrocollastatin; apoptotic toxin, SVMP, metalloproteinase, apoptosis, toxin; HET: NAG BMA MAN GM6; 2.15A {Crotalus atrox} PDB: 2dw1_A* 2dw2_A* 3dsl_A* 3hdb_A* Back     alignment and structure
>3k7n_A K-like; SVMP, hydrolase; HET: NAG FUC FUL; 2.30A {Naja atra} Back     alignment and structure
>3k7l_A Atragin; SVMP, metalloprotease, hydrolase; HET: NAG; 2.50A {Naja atra} Back     alignment and structure
>1lml_A Leishmanolysin; metalloprotease, glycoprotein; 1.86A {Leishmania major} SCOP: d.92.1.3 Back     alignment and structure
>3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, cell adhesion, cleavag of basic residues, EGF-like domain, glycoprotein, membrane, phosphoprotein; HET: NAG; 2.36A {Homo sapiens} Back     alignment and structure
>3p24_A BFT-3; metzincins, metalloendopeptidase, hydrolase; HET: PG4; 1.80A {Bacteroides fragilis} Back     alignment and structure
>3ujz_A Metalloprotease STCE; mucin-type glycoprotein, hydrolase; 2.50A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 184
d1asta_200 d.92.1.8 (A:) Astacin {European fresh water crayfi 6e-40
d1hy7a_168 d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo 4e-09
d1kapp2246 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas ae 3e-08
d1g9ka2242 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp 9e-07
d1hfca_157 d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Hum 1e-04
d1hv5a_162 d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus 2e-04
d1qiba_161 d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) 3e-04
d1sata2243 d.92.1.6 (A:4-246) Metalloprotease {Serratia marce 4e-04
d1mmqa_166 d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sap 7e-04
d1y93a1158 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) 0.001
d1k7ia2241 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrys 0.001
d1xuca1169 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Huma 0.002
d1i76a_163 d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Hum 0.002
>d1asta_ d.92.1.8 (A:) Astacin {European fresh water crayfish (Astacus astacus) [TaxId: 6715]} Length = 200 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Astacin
domain: Astacin
species: European fresh water crayfish (Astacus astacus) [TaxId: 6715]

 Score =  132 bits (333), Expect = 6e-40
 Identities = 46/124 (37%), Positives = 63/124 (50%), Gaps = 3/124 (2%)

Query: 61  AATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILF 120
           AA    E +W  GVIPY       G  ++     M+  E  TC++FV R  T   +Y+  
Sbjct: 1   AAILGDEYLWSGGVIPYTFA-GVSGADQSAILSGMQELEEKTCIRFVPR--TTESDYVEI 57

Query: 121 TEKPCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIR 180
                GC S+VG+    QQ       C   G ++HEL H +GF+HEHTR DRDN+V I  
Sbjct: 58  FTSGSGCWSYVGRISGAQQVSLQANGCVYHGTIIHELMHAIGFYHEHTRMDRDNYVTINY 117

Query: 181 ENIM 184
           +N+ 
Sbjct: 118 QNVD 121
>d1hy7a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1kapp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]} Length = 246 Back     information, alignment and structure
>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} Length = 242 Back     information, alignment and structure
>d1hfca_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]} Length = 162 Back     information, alignment and structure
>d1qiba_ d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1sata2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]} Length = 243 Back     information, alignment and structure
>d1mmqa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1y93a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]} Length = 158 Back     information, alignment and structure
>d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} Length = 241 Back     information, alignment and structure
>d1xuca1 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1i76a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} Length = 163 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
d1asta_200 Astacin {European fresh water crayfish (Astacus as 100.0
d1hy7a_168 Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibro 99.66
d1hv5a_162 Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxI 99.64
d1hfca_157 Fibroblast collagenase (MMP-1) {Human (Homo sapien 99.63
d1qiba_161 Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1mmqa_166 Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9 99.61
d1xuca1169 Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxI 99.57
d1y93a1158 Macrophage elastase (MMP-12) {Human (Homo sapiens) 99.57
d1i76a_163 Neutrophil collagenase (MMP-8) {Human (Homo sapien 99.56
d2ovxa1159 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 99.54
d1bqqm_174 Membrane-type matrix metalloproteinase (CDMT1-MMP) 99.5
d1rm8a_169 Matrix metalloproteinase-16 (MMP-16) {Human (Homo 99.49
d1kapp2246 Metalloprotease {Pseudomonas aeruginosa [TaxId: 28 99.41
d1k7ia2241 Metalloprotease {Erwinia chrysanthemi [TaxId: 556] 99.38
d1g9ka2242 Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId 99.34
d1sata2243 Metalloprotease {Serratia marcescens [TaxId: 615]} 99.3
d1c7ka_132 Zinc protease {Streptomyces caespitosus [TaxId: 53 98.16
d1bswa_197 Snake venom metalloprotease {Five-pace snake (Agki 95.99
d1quaa_197 Snake venom metalloprotease {Chinese five-pace sna 95.85
d1kufa_201 Snake venom metalloprotease {Taiwan habu (Trimeres 95.74
d1r55a_203 ADAM33 {Human (Homo sapiens) [TaxId: 9606]} 95.71
d2i47a1254 TNF-alpha converting enzyme, TACE, catalytic domai 95.71
d1atla_200 Snake venom metalloprotease {Western diamonback ra 95.7
d1nd1a_202 Snake venom metalloprotease {Terciopelo (Bothrops 95.59
d1lmla_ 475 Leishmanolysin {Leishmania major [TaxId: 5664]} 91.81
>d1asta_ d.92.1.8 (A:) Astacin {European fresh water crayfish (Astacus astacus) [TaxId: 6715]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Astacin
domain: Astacin
species: European fresh water crayfish (Astacus astacus) [TaxId: 6715]

Probab=100.00  E-value=2.5e-43  Score=283.78  Aligned_cols=120  Identities=38%  Similarity=0.730  Sum_probs=109.4

Q ss_pred             ccccCCCCCcCCCceEEEEcCCCCHHHHHHHHHHHHHhhcccceEEEEcCCCCCCcEEEEecCCCCcccccCCCCCCcce
Q psy2976          61 AATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQA  140 (184)
Q Consensus        61 ~a~~~~~~~Wp~g~IpY~~~~~~~~~~r~~I~~A~~~we~~TcV~F~e~~~~~~~~~I~f~~~~~gC~S~vG~~~~g~q~  140 (184)
                      +|+..+..+||+++|||.|+ +++...++.|++||++|++.|||+|++++.  +.++|.|...+.||||+||+.+ |.|.
T Consensus         1 ~ai~~~~~~Wp~~~VpY~~~-~~~~~~~~~I~~A~~~~~~~TcirF~~r~~--~~~~i~~~~~~~gC~S~vG~~~-g~q~   76 (200)
T d1asta_           1 AAILGDEYLWSGGVIPYTFA-GVSGADQSAILSGMQELEEKTCIRFVPRTT--ESDYVEIFTSGSGCWSYVGRIS-GAQQ   76 (200)
T ss_dssp             CEESCGGGSCGGGEEEEEEE-SCCHHHHHHHHHHHHHHHHHSSCEEEECSS--CSSEEEEESSSSSEEECSSCCS-SEEE
T ss_pred             CCccCccccCCCCEEEEEEC-CCCHHHHHHHHHHHHHHHhCcCceeeeCCC--CCCcEEEecCCCcccccCCeEC-Ccce
Confidence            35667788999999999997 588889999999999999999999999887  4678887666889999999988 8899


Q ss_pred             eec-CCCCchHHHHHHHHHHhhCCCCCCCCCCCCCceEeecccCC
Q psy2976         141 ISI-GKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIRENIM  184 (184)
Q Consensus       141 isl-~~~c~~~g~i~HElgHALG~~HEh~RpDRD~yV~I~~~NI~  184 (184)
                      |+| +.+|...|+|+|||||||||.|||+|||||+||+|+|+||.
T Consensus        77 ~~l~~~~c~~~g~i~HEl~HaLGf~HEh~RpDRD~yV~i~~~ni~  121 (200)
T d1asta_          77 VSLQANGCVYHGTIIHELMHAIGFYHEHTRMDRDNYVTINYQNVD  121 (200)
T ss_dssp             EEECTTTTCSHHHHHHHHHHHHTBCCGGGSTTGGGTEEECGGGBC
T ss_pred             EEeCCCCcCccCccHHHHHHHhcccchhhcccccceEEEeeeccC
Confidence            999 56799999999999999999999999999999999999985
>d1hy7a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Back     information, alignment and structure
>d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hfca_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qiba_ d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mmqa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xuca1 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y93a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i76a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovxa1 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqqm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kapp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} Back     information, alignment and structure
>d1sata2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1c7ka_ d.92.1.1 (A:) Zinc protease {Streptomyces caespitosus [TaxId: 53502]} Back     information, alignment and structure
>d1bswa_ d.92.1.9 (A:) Snake venom metalloprotease {Five-pace snake (Agkistrodon acutus), acutolysin A [TaxId: 36307]} Back     information, alignment and structure
>d1quaa_ d.92.1.9 (A:) Snake venom metalloprotease {Chinese five-pace snake (Agkistrodon acutus), acutolysin C [TaxId: 36307]} Back     information, alignment and structure
>d1kufa_ d.92.1.9 (A:) Snake venom metalloprotease {Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId: 103944]} Back     information, alignment and structure
>d1r55a_ d.92.1.9 (A:) ADAM33 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i47a1 d.92.1.10 (A:220-473) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1atla_ d.92.1.9 (A:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId: 8730]} Back     information, alignment and structure
>d1nd1a_ d.92.1.9 (A:) Snake venom metalloprotease {Terciopelo (Bothrops asper), bap1 [TaxId: 8722]} Back     information, alignment and structure
>d1lmla_ d.92.1.3 (A:) Leishmanolysin {Leishmania major [TaxId: 5664]} Back     information, alignment and structure