Diaphorina citri psyllid: psy2989


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60------
MAMALSDMFTLLFPAPWLFYMYTFGNHYKPLSPVAACYAWNIMNEVIPTLFHTASIWLTLALAVQR
cHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
*AMALSDMFTLLFPAPWLFYMYTFGNHYKPLSPVAACYAWNIMNEVIPTLFHTASIWLTLALAVQR
xxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMALSDMFTLLFPAPWLFYMYTFGNHYKPLSPVAACYAWNIMNEVIPTLFHTASIWLTLALAVQR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008188 [MF]neuropeptide receptor activityprobableGO:0008528, GO:0004930, GO:0030594, GO:0038023, GO:0060089, GO:0004888, GO:0001653, GO:0003674, GO:0004872, GO:0004871
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GRV, chain A
Confidence level:confident
Coverage over the Query: 15-66
View the alignment between query and template
View the model in PyMOL