Diaphorina citri psyllid: psy3014


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570
MENLQSLVYEVSLLKDKGNAALQANNFIEAIEAYSEAIKLDGTNHILFSNRSAAFAKEGNYEKALEDAEKTISLKPDWPKGYSRKGSALSYLGRYKESISTYEEGLKLDPNNEQMKEAIKDVRNQEMNDMNRGDPFANLFSDPNIFVQLQLDPRTKPFLSDPSYVQMIKEIQKDPSLMTTKLKDPRMMTTLSVLLGVNMSSTMGDGDAEEMDVDPQPPSPKKAPSPPPAKKPAEPEDKNLTDEQRSAKKEKELGNEAYKKKNFEEALAHYNKAVEFDPTDITFQNNIAAVYFERKEYDQCIEQYIQKIENRADFKLIAKALQRIGNCYKKMEDWKNAKVYFEKSMSEHRTPEIRTLISEMEKKIKEEEKKAYIDPVKAEEAKERGNELFKNGKYADAVKEYTEAINRNPDDPKYYSNRAACYTKLAAFDLGLKDCETCLKLDPKFLKGWIRKGKILQGMQQQSKAIDAYEKALELDASNAEAVEGYRQCSIAVSSNPEEVRKRAMGDPEVQQILRDPAMRLILEQMQNDPRALSDHLKNPEIASKIQKLVNSGLIVLAFIFLSISVYVKM
cccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHccHHHHHHHccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHccHHHHHHHHHHHccHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHcc
*E****LVYEVSLLKDKGNAALQANNFIEAIEAYSEAIKLDGTNHILFSNRSAAFAKEGNYEKALEDAEKTISLKPDWPKGYSRKGSALSYLGRYKESISTYEEGLKLDPNNEQMKEAIKDVRNQEMNDMNRGDPFANLFSDPNIFVQLQLDPRTKPFLSDPSYVQMIKEIQKDPSLMTTKLKDPRMMTTLSVLLGVNMSSTMGD*******************************DKNLTDEQRSAKKEKELGNEAYKKKNFEEALAHYNKAVEFDPTDITFQNNIAAVYFERKEYDQCIEQYIQKIENRADFKLIAKALQRIGNCYKKMEDWKNAKVYFEKSMSEHRTPEIRTLISEMEKKIKEEEKKAYIDPVKAEEAKERGNELFKNGKYADAVKEYTEAINRNPDDPKYYSNRAACYTKLAAFDLGLKDCETCLKLDPKFLKGWIRKGKILQGMQQQSKAIDAYEKALELDASNAEAVEGYRQCSI**********KRAMGDPEVQQILRDPAMRLILEQMQNDPRALSDHLKNPEIASKIQKLVNSGLIVLAFIFLSISVYVKM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENLQSLVYEVSLLKDKGNAALQANNFIEAIEAYSEAIKLDGTNHILFSNRSAAFAKEGNYEKALEDAEKTISLKPDWPKGYSRKGSALSYLGRYKESISTYEEGLKLDPNNEQMKEAIKDVRNQEMNDMNRGDPFANLFSDPNIFVQLQLDPRTKPFLSDPSYVQMIKEIQKDPSLMTTKLKDPRMMTTLSVLLGVNMSSTMGDGDAEEMDVDPQPPSPKKAPSPPPAKKPAEPEDKNLTDEQRSAKKEKELGNEAYKKKNFEEALAHYNKAVEFDPTDITFQNNIAAVYFERKEYDQCIEQYIQKIENRADFKLIAKALQRIGNCYKKMEDWKNAKVYFEKSMSEHRTPEIRTLISEMEKKIKEEEKKAYIDPVKAEEAKERGNELFKNGKYADAVKEYTEAINRNPDDPKYYSNRAACYTKLAAFDLGLKDCETCLKLDPKFLKGWIRKGKILQGMQQQSKAIDAYEKALELDASNAEAVEGYRQCSIAVSSNPEEVRKRAMGDPEVQQILRDPAMRLILEQMQNDPRALSDHLKNPEIASKIQKLVNSGLIVLAFIFLSISVYVKM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Stress-induced-phosphoprotein 1 Mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).very confidentQ3ZBZ8
Stress-induced-phosphoprotein 1 Mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).very confidentO54981
Stress-induced-phosphoprotein 1 Mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).very confidentP31948

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043234 [CC]protein complexconfidentGO:0005575, GO:0032991
GO:0043231 [CC]intracellular membrane-bounded organelleconfidentGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005515 [MF]protein bindingconfidentGO:0003674, GO:0005488
GO:0044444 [CC]cytoplasmic partconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0008022 [MF]protein C-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0006986 [BP]response to unfolded proteinprobableGO:0050896, GO:0006950, GO:0035966, GO:0008150, GO:0042221, GO:0010033
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030544 [MF]Hsp70 protein bindingprobableGO:0031072, GO:0003674, GO:0005488, GO:0005515
GO:0009408 [BP]response to heatprobableGO:0009628, GO:0006950, GO:0008150, GO:0050896, GO:0009266
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0051087 [MF]chaperone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0042030 [MF]ATPase inhibitor activityprobableGO:0003674, GO:0004857, GO:0060589, GO:0030234, GO:0060590
GO:0006457 [BP]protein foldingprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0051879 [MF]Hsp90 protein bindingprobableGO:0031072, GO:0003674, GO:0005488, GO:0005515
GO:0046686 [BP]response to cadmium ionprobableGO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0032780 [BP]negative regulation of ATPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0031329, GO:0031323, GO:0050789, GO:0043462, GO:0043086, GO:0051346, GO:0030811, GO:0065007, GO:0044092, GO:0065009, GO:0033121, GO:0019219, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0019222, GO:0009118, GO:0051336, GO:1900542, GO:0006140

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W3B, chain A
Confidence level:very confident
Coverage over the Query: 15-140,241-495
View the alignment between query and template
View the model in PyMOL
Template: 3FP2, chain A
Confidence level:very confident
Coverage over the Query: 4-132,161-171,192-195,241-346,373-487
View the alignment between query and template
View the model in PyMOL
Template: 2GW1, chain A
Confidence level:very confident
Coverage over the Query: 8-172,193-201,233-346,373-498
View the alignment between query and template
View the model in PyMOL
Template: 2LLW, chain A
Confidence level:confident
Coverage over the Query: 494-558
View the alignment between query and template
View the model in PyMOL
Template: 4E6H, chain A
Confidence level:confident
Coverage over the Query: 3-140,151-202,214-495
View the alignment between query and template
View the model in PyMOL