Diaphorina citri psyllid: psy3030


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MVTHPNTYHASLADADNVIPRQLTPEILSAFEGVRFIAQHIKDADKDNEIVEDWKYVSMVLDRFFLCVFTAACVLGTCGIIFQAPSLYDNTAPIDIQMTRITQYGISSPPTVAPRL
ccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccc
********************RQLTPEILSAFEGVRFIAQHIKDADKDNEIVEDWKYVSMVLDRFFLCVFTAACVLGTCGIIFQAPSLYDNTAPIDIQMTRITQYGI****T*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTHPNTYHASLADADNVIPRQLTPEILSAFEGVRFIAQHIKDADKDNEIVEDWKYVSMVLDRFFLCVFTAACVLGTCGIIFQAPSLYDNTAPIDIQMTRITQYGISSPPTVAPRL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acetylcholine receptor subunit beta-like 2 After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.confidentP25162
Neuronal acetylcholine receptor subunit beta-4 After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.confidentP30926
Neuronal acetylcholine receptor subunit beta-4 After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.confidentQ8SPU6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005892 [CC]acetylcholine-gated channel complexprobableGO:0043234, GO:0043235, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0034702, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0015464 [MF]acetylcholine receptor activityprobableGO:0030594, GO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871
GO:0006281 [BP]DNA repairprobableGO:0090304, GO:0034641, GO:0006807, GO:0044699, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0051291 [BP]protein heterooligomerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0009897 [CC]external side of plasma membraneprobableGO:0009986, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0001508 [BP]regulation of action potentialprobableGO:0019725, GO:0042391, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0007626 [BP]locomotory behaviorprobableGO:0044708, GO:0050896, GO:0008150, GO:0007610
GO:0035095 [BP]behavioral response to nicotineprobableGO:0009719, GO:0030534, GO:0050896, GO:0032501, GO:0044707, GO:0044708, GO:0010243, GO:1901698, GO:0035094, GO:0007610, GO:0008150, GO:0044699, GO:0042221, GO:0043279, GO:0010033, GO:0014070
GO:0006979 [BP]response to oxidative stressprobableGO:0006950, GO:0008150, GO:0050896
GO:0007271 [BP]synaptic transmission, cholinergicprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007268, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0007274 [BP]neuromuscular synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007268, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0051239 [BP]regulation of multicellular organismal processprobableGO:0008150, GO:0065007, GO:0050789
GO:0042166 [MF]acetylcholine bindingprobableGO:0043169, GO:0042165, GO:0043167, GO:0003674, GO:0050997, GO:0005488
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0006816 [BP]calcium ion transportprobableGO:0072511, GO:0006812, GO:0006811, GO:0006810, GO:0008150, GO:0044765, GO:0030001, GO:0070838, GO:0051234, GO:0051179, GO:0044699
GO:0008306 [BP]associative learningprobableGO:0032501, GO:0044707, GO:0050877, GO:0050896, GO:0050890, GO:0007610, GO:0007611, GO:0008150, GO:0044699, GO:0044708, GO:0007612, GO:0003008
GO:0042113 [BP]B cell activationprobableGO:0009987, GO:0002376, GO:0045321, GO:0001775, GO:0046649, GO:0044763, GO:0008150, GO:0044699
GO:0014059 [BP]regulation of dopamine secretionprobableGO:0032879, GO:0060341, GO:0051046, GO:0051049, GO:0050794, GO:0008150, GO:0050433, GO:0023051, GO:0051952, GO:0065007, GO:0010646, GO:0050789, GO:0043269
GO:0034220 [BP]ion transmembrane transportprobableGO:0009987, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0044763, GO:0008150, GO:0051234, GO:0055085, GO:0044699
GO:0004889 [MF]acetylcholine-activated cation-selective channel activityprobableGO:0022891, GO:0008324, GO:0005261, GO:0022892, GO:0005215, GO:0005230, GO:0005231, GO:0015276, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022836, GO:0022834, GO:0022803, GO:0022839, GO:0022838, GO:0005216
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0008144 [MF]drug bindingprobableGO:0003674, GO:0005488
GO:0001666 [BP]response to hypoxiaprobableGO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0044456 [CC]synapse partprobableGO:0005575, GO:0045202

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OED, chain A
Confidence level:very confident
Coverage over the Query: 58-84
View the alignment between query and template
View the model in PyMOL