Diaphorina citri psyllid: psy303


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--
MKKTILKDIQNGIIQLEIENFNILLHGFGSKYKVINEFHKKMLSNSKVLVINGFFPDLTLKE
cHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHcccccEEEEccccccccccc
****ILKDIQNGIIQLEIENFNILLHGFGSKYKVINEFHKKMLSNSKVLVINGFFPDL****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKTILKDIQNGIIQLEIENFNILLHGFGSKYKVINEFHKKMLSNSKVLVINGFFPDLTLKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Origin recognition complex subunit 2 Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication.confidentQ24168

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005723 [CC]alpha-heterochromatinprobableGO:0005721, GO:0044427, GO:0005575, GO:0043232, GO:0044464, GO:0044446, GO:0005700, GO:0010369, GO:0000792, GO:0043229, GO:0043228, GO:0000785, GO:0005623, GO:0043226, GO:0044424, GO:0005701, GO:0005694, GO:0000775, GO:0044422, GO:0005622
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted