Diaphorina citri psyllid: psy3045

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------

MVGSDLKPVGFKAPTFSSVSDIIRFKKPGGESFALLCEAQENMWFKFIEGSSRKVAVPLNDRVKQVSGTLIIKEAKVEDSGKYLCVVNNSVGGESVETVLTVTAPLAAGVEPTVQTIDFGRPAQFTCKYEISPPLAAGVEPTVQTIDFGRPAQFTCKYEGNPVKTISWMKDGKPVPDHNEPVFRIDSVRKEDKGMYQCVIRNEQESAQASGELKLGGRFDPPVIKESFSDETLNPGPNYYFKCIASGNPTPEISWYLDGKKLVNAER

ccccccccccccccCEECccccCEEEEEccccEEEEEEEccccccEEEEccccccccccccEEEEEEcEEEEccccccccEEEEEEEEEcccEEEEEEEEEEEccccccccccCEECcccccccccccccccccccccccccCEEEcccccEEEEEEEEECcccEEEEEEccCEcccccccEEEEccccccccEEEEEEEEEcccEEEEEEEEEEEccccccEEEEcccCEEEcccccEEEEEEEEECcccEEEEEEccCEcccccc

MVGSD*KPVGFKAPTFSSVSDIIRFKKPGGESFALLCEAQENMWFKFIEGSSRKVAVPLNDRVKQVSGTLIIKEAKVEDSGKYLCVVNNSVGGESVETVLTVTAPLAA**********************ISPPLAAGVEPTVQTIDFGRPAQFTCKYEGNPVKTISWMKDGKPVPDHNEPVFRIDSVRKEDKGMYQCVIRNEQESAQASGELKLGGRFDPPVIKESFSDETLNPGPNYYFKCIASGNPTPEISWYLDGKKL*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0048666 [BP]	neuron development	probable	GO:0032502, GO:0048699, GO:0048856, GO:0007399, GO:0030182, GO:0009987, GO:0048869, GO:0030154, GO:0048468, GO:0044767, GO:0032501, GO:0044763, GO:0048731, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0044707
GO:0048513 [BP]	organ development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0048518 [BP]	positive regulation of biological process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0044430 [CC]	cytoskeletal part	probable	GO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0044425 [CC]	membrane part	probable	GO:0005575, GO:0016020
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0009986 [CC]	cell surface	probable	GO:0005575, GO:0044464, GO:0005623
GO:0051179 [BP]	localization	probable	GO:0008150
GO:0016043 [BP]	cellular component organization	probable	GO:0008150, GO:0071840
GO:0005576 [CC]	extracellular region	probable	GO:0005575
GO:0044463 [CC]	cell projection part	probable	GO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0051635 [MF]	bacterial cell surface binding	probable
GO:0042221 [BP]	response to chemical stimulus	probable	GO:0050896, GO:0008150
GO:0030425 [CC]	dendrite	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030424 [CC]	axon	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 12-112,142-266
View the alignment between query and template
View the model in PyMOL

Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 12-262
View the alignment between query and template
View the model in PyMOL