Diaphorina citri psyllid: psy3049


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGAVKNLSPDLWQFTHLTALYMNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGDLIYLRELCLNNNNLRTLPYELGKLFQIQILGLHGNPLSKDYMKIYNEPNGTQKLLSYLLDSLQ
ccccccccccHHHHccccccEEEccccccccccHHHHccccccHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHcccccHHHHHHHHHHHcc
****NLTRLSGDISLLINLRTLDISNNKLRYLPSEIGAVKNLSPDLWQFTHLTALYMNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGDLIYLRELCLNNNNLRTLPYELGKLFQIQILGLHGNPLSKDYMKIYNEPNGTQKLLSYLLDS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGAVKNLSPDLWQFTHLTALYMNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGDLIYLRELCLNNNNLRTLPYELGKLFQIQILGLHGNPLSKDYMKIYNEPNGTQKLLSYLLDSLQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CCR4-NOT transcription complex subunit 6-like Plays a role in the regulation of cell growth through its deadenylase activity. Displays 3'-5' poly(A) exoribonuclease activity.confidentA2BHJ4
CCR4-NOT transcription complex subunit 6-like Plays a role in the deadenylation of mRNAs in the cytoplasm. Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. May be involved in the deadenylation-dependent degradation of mRNAs through the 3'-UTR AU-rich element-mediated mechanism. Involved in deadenylation-dependent degradation of CDKN1B mRNA.confidentQ8VEG6
CCR4-NOT transcription complex subunit 6 Poly(A) nuclease involved in mRNA decay mediated by the major-protein-coding determinant of instability (mCRD) of the FOS gene in the cytoplasm. Has 3'-5' RNase activity. The CCR4-NOT complex functions as general transcription regulation complex.confidentQ9ULM6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0000288 [BP]nuclear-transcribed mRNA catabolic process, deadenylation-dependent decayprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0006402, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0000956, GO:0019439
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0030054 [CC]cell junctionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 1-142
View the alignment between query and template
View the model in PyMOL