Psyllid ID: psy3049


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGAVKNLSPDLWQFTHLTALYMNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGDLIYLRELCLNNNNLRTLPYELGKLFQIQILGLHGNPLSKDYMKIYNEPNGTQKLLSYLLDSLQ
ccccccccccHHHHccccccEEEccccccccccHHHHccccccHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEcccccccccHHHHHcccccHHHHHHHHHHHcc
ccccccccccHHHHHHHcccEEEccccccccccHHHHHHccccHHHHHHHcccEEEccccccccccHHHHHHHcccEEEccccccccccHHHHHHHcccEEEccccccccccHHHHHHHcccEEEccccccccccHHHHHHHHHHHHHHHHHHHccc
mndnnltrlsgDISLLINLrtldisnnklrylpseigavknlspdlwqfTHLTALymndnnltrlsGDISLLINLrtldisnnklrylpseiGDLIYLRELCLnnnnlrtlpyeLGKLFQIQILglhgnplskdymkiynepngTQKLLSYLLDSLQ
MNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGAVKNLSPDLWQFTHLTALYMNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGDLIYLRELCLNNNNLRTLPYELGKLFQIQILGLHGNPLSKDYMKIYNEPNGTQKLLSYLLDSLQ
MNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGAVKNLSPDLWQFTHLTALYMNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGDLIYlrelclnnnnlrtlPYELGKLFQIQILGLHGNPLSKDYMKIYNEPNGTQKLLSYLLDSLQ
*********SGDISLLINLRTLDISNNKLRYLPSEIGAVKNLSPDLWQFTHLTALYMNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGDLIYLRELCLNNNNLRTLPYELGKLFQIQILGLHGNPLSKDYMKIYNEPNGTQKLLSYL*****
MNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGAVKNLSPDLWQFTHLTALYMNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGDLIYLRELCLNNNNLRTLPYELGKLFQIQILGLHGNPLSKDYMKIYNEPNGTQKLLSYLLDS**
********LSGDISLLINLRTLDISNNKLRYLPSEIGAVKNLSPDLWQFTHLTALYMNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGDLIYLRELCLNNNNLRTLPYELGKLFQIQILGLHGNPLSKDYMKIYNEPNGTQKLLSYLLDSLQ
****NLTRLSGDISLLINLRTLDISNNKLRYLPSEIGAVKNLSPDLWQFTHLTALYMNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGDLIYLRELCLNNNNLRTLPYELGKLFQIQILGLHGNPLSKDYMKIYNEPNGTQKLLSYLLDSLQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGAVKNLSPDLWQFTHLTALYMNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGDLIYLRELCLNNNNLRTLPYELGKLFQIQILGLHGNPLSKDYMKIYNEPNGTQKLLSYLLDSLQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query157 2.2.26 [Sep-21-2011]
Q8VEG6 555 CCR4-NOT transcription co yes N/A 0.853 0.241 0.566 9e-36
Q9ULM6 557 CCR4-NOT transcription co yes N/A 0.764 0.215 0.591 4e-35
A2BHJ4 559 CCR4-NOT transcription co yes N/A 0.840 0.236 0.563 1e-34
Q96LI5 555 CCR4-NOT transcription co no N/A 0.853 0.241 0.558 5e-28
Q6IR85 550 CCR4-NOT transcription co N/A N/A 0.764 0.218 0.583 5e-27
Q5XH73 550 CCR4-NOT transcription co N/A N/A 0.764 0.218 0.583 8e-27
Q6AXU9 557 CCR4-NOT transcription co no N/A 0.764 0.215 0.541 1e-26
Q8K3P5 557 CCR4-NOT transcription co no N/A 0.764 0.215 0.541 1e-26
Q5BJ41 552 CCR4-NOT transcription co N/A N/A 0.764 0.217 0.541 1e-26
P0CP23 744 Glucose-repressible alcoh N/A N/A 0.732 0.154 0.491 4e-23
>sp|Q8VEG6|CNO6L_MOUSE CCR4-NOT transcription complex subunit 6-like OS=Mus musculus GN=Cnot6l PE=1 SV=2 Back     alignment and function desciption
 Score =  149 bits (375), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 77/136 (56%), Positives = 106/136 (77%), Gaps = 2/136 (1%)

Query: 23  DISNNKLRYLPS-EI-GAVKNLSPDLWQFTHLTALYMNDNNLTRLSGDISLLINLRTLDI 80
           +++N K  +    EI G V++LS  LW  THLTAL++NDNNL R+  DI+ L NL  LD+
Sbjct: 27  EVANGKKSHWAELEISGRVRSLSTSLWSLTHLTALHLNDNNLARIPPDIAKLHNLVYLDL 86

Query: 81  SNNKLRYLPSEIGDLIYLRELCLNNNNLRTLPYELGKLFQIQILGLHGNPLSKDYMKIYN 140
           S+NKLR LP+E+G+++ LREL LN+N LR LPYELG+LFQ+Q LGL GNPLS+D M +Y 
Sbjct: 87  SSNKLRSLPAELGNMVSLRELLLNDNYLRVLPYELGRLFQLQTLGLTGNPLSQDIMSLYQ 146

Query: 141 EPNGTQKLLSYLLDSL 156
           +P+GT+KLL+++LD+L
Sbjct: 147 DPDGTRKLLNFMLDNL 162




Plays a role in the deadenylation of mRNAs in the cytoplasm. Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. May be involved in the deadenylation-dependent degradation of mRNAs through the 3'-UTR AU-rich element-mediated mechanism. Involved in deadenylation-dependent degradation of CDKN1B mRNA.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 1EC: .EC: -EC: .EC: -
>sp|Q9ULM6|CNOT6_HUMAN CCR4-NOT transcription complex subunit 6 OS=Homo sapiens GN=CNOT6 PE=1 SV=2 Back     alignment and function description
>sp|A2BHJ4|CNO6L_DANRE CCR4-NOT transcription complex subunit 6-like OS=Danio rerio GN=cnot6l PE=2 SV=1 Back     alignment and function description
>sp|Q96LI5|CNO6L_HUMAN CCR4-NOT transcription complex subunit 6-like OS=Homo sapiens GN=CNOT6L PE=1 SV=2 Back     alignment and function description
>sp|Q6IR85|CN6LA_XENLA CCR4-NOT transcription complex subunit 6-like-A OS=Xenopus laevis GN=cnot6l-a PE=2 SV=1 Back     alignment and function description
>sp|Q5XH73|CN6LB_XENLA CCR4-NOT transcription complex subunit 6-like-B OS=Xenopus laevis GN=cnot6l-b PE=2 SV=1 Back     alignment and function description
>sp|Q6AXU9|CNOT6_RAT CCR4-NOT transcription complex subunit 6 OS=Rattus norvegicus GN=Cnot6 PE=2 SV=1 Back     alignment and function description
>sp|Q8K3P5|CNOT6_MOUSE CCR4-NOT transcription complex subunit 6 OS=Mus musculus GN=Cnot6 PE=1 SV=2 Back     alignment and function description
>sp|Q5BJ41|CNOT6_XENLA CCR4-NOT transcription complex subunit 6 OS=Xenopus laevis GN=cnot6 PE=2 SV=1 Back     alignment and function description
>sp|P0CP23|CCR4_CRYNB Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CCR4 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
345486629 560 PREDICTED: CCR4-NOT transcription comple 0.885 0.248 0.645 1e-44
350398118163 PREDICTED: CCR4-NOT transcription comple 0.885 0.852 0.652 3e-44
380018055 547 PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT 0.885 0.254 0.645 6e-44
340720404 836 PREDICTED: CCR4-NOT transcription comple 0.885 0.166 0.645 8e-44
312371132 1435 hypothetical protein AND_22617 [Anophele 0.764 0.083 0.7 9e-44
328782365168 PREDICTED: CCR4-NOT transcription comple 0.885 0.827 0.638 4e-43
383847523172 PREDICTED: CCR4-NOT transcription comple 0.885 0.808 0.645 4e-43
307206315163 CCR4-NOT transcription complex subunit 6 0.885 0.852 0.631 4e-42
242007260182 conserved hypothetical protein [Pediculu 0.770 0.664 0.685 2e-41
24649579 567 twin, isoform C [Drosophila melanogaster 0.764 0.211 0.683 4e-41
>gi|345486629|ref|XP_001605640.2| PREDICTED: CCR4-NOT transcription complex subunit 6-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 115/141 (81%), Gaps = 2/141 (1%)

Query: 19  LRTLDISNNKLRYLPS-EI-GAVKNLSPDLWQFTHLTALYMNDNNLTRLSGDISLLINLR 76
           + T D ++ K  Y P  EI G+++NLSP++WQ THLTALY+NDN+L R+  +I  L+NLR
Sbjct: 32  MSTEDANSGKKSYWPELEITGSIRNLSPNVWQLTHLTALYLNDNSLQRIPSEIGRLVNLR 91

Query: 77  TLDISNNKLRYLPSEIGDLIYLRELCLNNNNLRTLPYELGKLFQIQILGLHGNPLSKDYM 136
            LD+S+NKLR LP+E+GDLIYL+EL LN N LR LPYELGKLFQ+Q+LGLHGNPLSKD M
Sbjct: 92  ALDLSSNKLRSLPAELGDLIYLKELLLNQNFLRVLPYELGKLFQLQVLGLHGNPLSKDVM 151

Query: 137 KIYNEPNGTQKLLSYLLDSLQ 157
            +Y EP+GT KLLSY+LD+LQ
Sbjct: 152 TLYGEPSGTHKLLSYMLDNLQ 172




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350398118|ref|XP_003485093.1| PREDICTED: CCR4-NOT transcription complex subunit 6-like isoform 1 [Bombus impatiens] gi|350398121|ref|XP_003485094.1| PREDICTED: CCR4-NOT transcription complex subunit 6-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|380018055|ref|XP_003692952.1| PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT transcription complex subunit 6-like [Apis florea] Back     alignment and taxonomy information
>gi|340720404|ref|XP_003398629.1| PREDICTED: CCR4-NOT transcription complex subunit 6-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|312371132|gb|EFR19392.1| hypothetical protein AND_22617 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|328782365|ref|XP_396628.3| PREDICTED: CCR4-NOT transcription complex subunit 6-like [Apis mellifera] Back     alignment and taxonomy information
>gi|383847523|ref|XP_003699402.1| PREDICTED: CCR4-NOT transcription complex subunit 6-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307206315|gb|EFN84372.1| CCR4-NOT transcription complex subunit 6-like [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242007260|ref|XP_002424460.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212507860|gb|EEB11722.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|24649579|ref|NP_732964.1| twin, isoform C [Drosophila melanogaster] gi|23172140|gb|AAN13986.1| twin, isoform C [Drosophila melanogaster] gi|33589482|gb|AAQ22508.1| LD39302p [Drosophila melanogaster] gi|220950318|gb|ACL87702.1| twin-PA [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
FB|FBgn0011725 567 twin "twin" [Drosophila melano 0.853 0.236 0.558 9.1e-36
UNIPROTKB|E1C5L3 549 CNOT6L "Uncharacterized protei 0.853 0.244 0.5 8.4e-31
RGD|1309128 553 Cnot6l "CCR4-NOT transcription 0.853 0.242 0.492 5.3e-30
MGI|MGI:2443154 555 Cnot6l "CCR4-NOT transcription 0.853 0.241 0.492 5.4e-30
UNIPROTKB|D6RGK9163 CNOT6L "CCR4-NOT transcription 0.853 0.822 0.477 1.6e-29
UNIPROTKB|A6QR51 557 CNOT6 "CNOT6 protein" [Bos tau 0.840 0.236 0.481 3.4e-29
UNIPROTKB|Q96LI5 555 CNOT6L "CCR4-NOT transcription 0.853 0.241 0.477 5.5e-29
UNIPROTKB|F1RYS2 557 CNOT6L "Uncharacterized protei 0.853 0.240 0.477 5.6e-29
UNIPROTKB|Q9ULM6 557 CNOT6 "CCR4-NOT transcription 0.840 0.236 0.473 9.3e-29
UNIPROTKB|E1C678 557 CNOT6 "Uncharacterized protein 0.840 0.236 0.473 1.2e-28
FB|FBgn0011725 twin "twin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 387 (141.3 bits), Expect = 9.1e-36, P = 9.1e-36
 Identities = 76/136 (55%), Positives = 97/136 (71%)

Query:    23 DIS-NNKLRYLPSEI-GAVKNLSPDLWQFTHLTALYMNDNNLTRLSGDISLLINLRTLDI 80
             DI+   K  +   EI G V+N+SP LW+F HLTALY+NDN L RL  D+ +L +LRTLD+
Sbjct:    45 DIAAGKKTNWSGLEITGCVRNISPSLWEFEHLTALYLNDNQLLRLPADVGMLTSLRTLDL 104

Query:    81 SNNKLRYLPSEIGDLIYXXXXXXXXXXXXXXPYELGKLFQIQILGLHGNPLSKDYMKIYN 140
             S+NKLR LP+E+G+LI               PYE+GKLF + ILGL GNPL K++M IYN
Sbjct:   105 SSNKLRSLPAELGELIQLRELLLNNNFLRVLPYEIGKLFHLVILGLMGNPLQKEFMNIYN 164

Query:   141 EPNGTQKLLSYLLDSL 156
             EPNGTQKLL+Y+LD+L
Sbjct:   165 EPNGTQKLLTYMLDNL 180


GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=ISS
GO:0000288 "nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay" evidence=ISS
GO:0030014 "CCR4-NOT complex" evidence=ISS;IDA
GO:0005737 "cytoplasm" evidence=ISS;IDA
GO:0000289 "nuclear-transcribed mRNA poly(A) tail shortening" evidence=IMP
GO:0048477 "oogenesis" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
UNIPROTKB|E1C5L3 CNOT6L "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1309128 Cnot6l "CCR4-NOT transcription complex, subunit 6-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2443154 Cnot6l "CCR4-NOT transcription complex, subunit 6-like" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|D6RGK9 CNOT6L "CCR4-NOT transcription complex subunit 6-like" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A6QR51 CNOT6 "CNOT6 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q96LI5 CNOT6L "CCR4-NOT transcription complex subunit 6-like" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RYS2 CNOT6L "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ULM6 CNOT6 "CCR4-NOT transcription complex subunit 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C678 CNOT6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8VEG6CNO6L_MOUSE3, ., 1, ., -, ., -0.56610.85350.2414yesN/A
A2BHJ4CNO6L_DANRE3, ., 1, ., -, ., -0.56390.84070.2361yesN/A
Q9ULM6CNOT6_HUMAN3, ., 1, ., -, ., -0.59160.76430.2154yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-08
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-07
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 1e-04
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 1e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 9e-04
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 0.002
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 0.003
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 0.004
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 49.6 bits (118), Expect = 9e-08
 Identities = 44/131 (33%), Positives = 65/131 (49%), Gaps = 10/131 (7%)

Query: 2   NDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGAVKNLSPDLWQFTHLTALYMNDNN 61
           +DN +  L   +  L NL+ LD+S N L  LP  +  + NL            L ++ N 
Sbjct: 148 SDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNL----------NNLDLSGNK 197

Query: 62  LTRLSGDISLLINLRTLDISNNKLRYLPSEIGDLIYLRELCLNNNNLRTLPYELGKLFQI 121
           ++ L  +I LL  L  LD+SNN +  L S + +L  L  L L+NN L  LP  +G L  +
Sbjct: 198 ISDLPPEIELLSALEELDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIGNLSNL 257

Query: 122 QILGLHGNPLS 132
           + L L  N +S
Sbjct: 258 ETLDLSNNQIS 268


Length = 394

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 157
KOG0617|consensus264 99.79
KOG0617|consensus264 99.64
KOG0472|consensus565 99.62
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.59
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.57
KOG0472|consensus 565 99.56
KOG4194|consensus 873 99.55
KOG4194|consensus 873 99.54
KOG0444|consensus 1255 99.54
KOG0532|consensus 722 99.54
KOG0444|consensus 1255 99.47
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.44
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.37
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.33
KOG1259|consensus490 99.32
KOG0618|consensus 1081 99.31
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.25
KOG0532|consensus 722 99.17
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.16
KOG0618|consensus 1081 99.13
KOG4237|consensus 498 99.06
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.06
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.01
KOG4579|consensus177 99.0
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.99
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.98
PLN03150623 hypothetical protein; Provisional 98.98
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.96
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.96
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.95
PLN03150623 hypothetical protein; Provisional 98.94
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.93
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.91
KOG1259|consensus490 98.86
KOG4579|consensus177 98.85
KOG4237|consensus 498 98.78
KOG1859|consensus 1096 98.65
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.56
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.49
KOG4658|consensus 889 98.46
KOG4658|consensus 889 98.41
KOG3207|consensus 505 98.36
KOG0531|consensus 414 98.34
KOG1859|consensus 1096 98.3
KOG1644|consensus233 98.23
KOG0531|consensus 414 98.23
KOG3207|consensus 505 98.08
KOG1644|consensus233 98.07
KOG1909|consensus382 97.97
KOG1909|consensus382 97.75
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.67
PRK15386 426 type III secretion protein GogB; Provisional 97.6
KOG3665|consensus 699 97.56
KOG2739|consensus 260 97.56
KOG2739|consensus260 97.47
KOG3665|consensus 699 97.42
KOG2123|consensus 388 97.41
KOG2982|consensus 418 97.26
KOG0473|consensus 326 97.02
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.99
KOG2120|consensus419 96.92
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.92
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.85
KOG2982|consensus 418 96.84
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.72
PRK15386 426 type III secretion protein GogB; Provisional 96.68
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.58
KOG2120|consensus419 96.37
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.33
KOG2123|consensus 388 96.21
KOG0473|consensus 326 94.8
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.09
smart0037026 LRR Leucine-rich repeats, outliers. 94.09
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.1
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 89.84
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 89.75
KOG4308|consensus 478 87.6
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 87.05
KOG3864|consensus221 85.71
KOG1947|consensus 482 80.04
>KOG0617|consensus Back     alignment and domain information
Probab=99.79  E-value=2.2e-21  Score=125.19  Aligned_cols=137  Identities=33%  Similarity=0.538  Sum_probs=122.4

Q ss_pred             CCCCCCCccchhhhcccCCCEEEecCCcceecCccccCCCC-------------CChhhhcCcccceEecccCCCc--cc
Q psy3049           1 MNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGAVKN-------------LSPDLWQFTHLTALYMNDNNLT--RL   65 (157)
Q Consensus         1 l~~n~i~~l~~~~~~l~~L~~L~l~~~~l~~~~~~~~~~~~-------------~~~~~~~~~~L~~l~l~~~~~~--~~   65 (157)
                      +|+|.++-+|+.++++.+|+.|++.+|+++++|..++++++             +|..|..++.|+.+++..|++.  .+
T Consensus        40 LSHNKl~~vppnia~l~nlevln~~nnqie~lp~~issl~klr~lnvgmnrl~~lprgfgs~p~levldltynnl~e~~l  119 (264)
T KOG0617|consen   40 LSHNKLTVVPPNIAELKNLEVLNLSNNQIEELPTSISSLPKLRILNVGMNRLNILPRGFGSFPALEVLDLTYNNLNENSL  119 (264)
T ss_pred             cccCceeecCCcHHHhhhhhhhhcccchhhhcChhhhhchhhhheecchhhhhcCccccCCCchhhhhhccccccccccC
Confidence            58899999999999999999999999999999998876654             4888999999999999999987  56


Q ss_pred             cccccccccccEEeccCCCCCCCChhhhCccccceEEcCCCcccCcchhhcCcCCCcEEEccCCCCCChhHH
Q psy3049          66 SGDISLLINLRTLDISNNKLRYLPSEIGDLIYLRELCLNNNNLRTLPYELGKLFQIQILGLHGNPLSKDYMK  137 (157)
Q Consensus        66 ~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~l~~l~l~~n~l~~l~~~~~~~~~L~~l~l~~n~~~~~~~~  137 (157)
                      |..|..+..|+.|.+++|.+..+|..++.+++|+++.+++|.+-++|++++.+.+|+++++.+|+++-.+|+
T Consensus       120 pgnff~m~tlralyl~dndfe~lp~dvg~lt~lqil~lrdndll~lpkeig~lt~lrelhiqgnrl~vlppe  191 (264)
T KOG0617|consen  120 PGNFFYMTTLRALYLGDNDFEILPPDVGKLTNLQILSLRDNDLLSLPKEIGDLTRLRELHIQGNRLTVLPPE  191 (264)
T ss_pred             CcchhHHHHHHHHHhcCCCcccCChhhhhhcceeEEeeccCchhhCcHHHHHHHHHHHHhcccceeeecChh
Confidence            888888889999999999999999999999999999999999999999999999999999988888755444



>KOG0617|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 6e-16
2o6q_A 270 Structural Diversity Of The Hagfish Variable Lympho 5e-04
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure

Iteration: 1

Score = 79.7 bits (195), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 45/114 (39%), Positives = 66/114 (57%), Gaps = 1/114 (0%) Query: 41 NLSPDLWQFTHLTALYMNDNNLTRLSGDISLLINLRTLDISNNKLRYLPSEIGDLIYXXX 100 N+S +++++ LT LY+N N+LT L +I L NLR LD+S+N+L LP+E+G Sbjct: 238 NISANIFKYDFLTRLYLNGNSLTELPAEIKNLSNLRVLDLSHNRLTSLPAELGSCFQLKY 297 Query: 101 XXXXXXXXXXXPYELGKLFQIQILGLHGNPLSKDYMKIYNEPNGTQKLLSYLLD 154 P+E G L +Q LG+ GNPL K ++KI E + T L+ YL D Sbjct: 298 FYFFDNMVTTLPWEFGNLCNLQFLGVEGNPLEKQFLKILTEKSVT-GLIFYLRD 350
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-29
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-19
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-17
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-15
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-18
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-16
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-12
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-12
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-11
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-16
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-15
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-11
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-16
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-15
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-13
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-16
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-14
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 1e-11
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-13
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-12
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-16
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-14
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-12
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-15
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-15
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-14
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-14
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 4e-11
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 3e-10
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 8e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-11
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 2e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-13
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-13
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-12
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-10
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-12
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 7e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-11
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-09
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-11
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 8e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 8e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-09
3m19_A 251 Variable lymphocyte receptor A diversity region; a 8e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-12
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-12
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-12
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-12
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-10
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 5e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-12
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-11
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-10
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-10
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 9e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-07
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 4e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-09
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 5e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-09
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 7e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 5e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-08
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 8e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-06
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 6e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.83
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.83
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.82
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.79
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.78
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.77
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.77
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.77
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.77
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.76
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.76
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.76
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.76
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.76
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.76
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.74
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.74
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.73
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.73
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.73
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.73
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.72
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.72
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.71
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.71
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.71
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.71
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.71
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.7
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.7
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.7
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.7
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.7
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.7
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.7
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.69
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.69
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.69
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.68
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.68
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.68
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.68
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.68
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.68
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.67
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.67
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.66
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.66
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.66
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.66
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.66
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.66
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.66
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.65
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.65
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.65
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.65
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.64
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.64
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.63
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.63
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.63
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.63
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.63
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.63
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.63
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.63
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.62
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.62
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.62
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.62
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.62
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.62
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.62
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.61
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.61
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.61
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.61
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.61
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.6
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.59
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.59
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.58
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.58
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.58
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.57
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.56
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.56
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.55
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.54
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.53
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.53
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.52
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.52
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.51
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.51
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.5
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.49
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.44
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.42
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.4
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.38
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.38
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.37
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.32
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.26
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.26
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.22
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.18
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.17
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.14
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.06
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.99
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.87
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.79
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.71
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.56
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.53
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.44
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.37
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.34
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.29
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.28
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.24
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.0
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.78
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.72
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.7
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.67
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.41
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.32
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.3
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.27
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.13
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.98
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.83  E-value=8.9e-21  Score=136.10  Aligned_cols=32  Identities=31%  Similarity=0.504  Sum_probs=14.0

Q ss_pred             CCCCCccchhhhcccCCCEEEecCCcceecCc
Q psy3049           3 DNNLTRLSGDISLLINLRTLDISNNKLRYLPS   34 (157)
Q Consensus         3 ~n~i~~l~~~~~~l~~L~~L~l~~~~l~~~~~   34 (157)
                      +|.++.+|..+..+++|+.|++++|.++.+|+
T Consensus       113 ~n~l~~lp~~~~~l~~L~~L~Ls~n~l~~lp~  144 (328)
T 4fcg_A          113 AAGLMELPDTMQQFAGLETLTLARNPLRALPA  144 (328)
T ss_dssp             SSCCCCCCSCGGGGTTCSEEEEESCCCCCCCG
T ss_pred             CCCccchhHHHhccCCCCEEECCCCccccCcH
Confidence            34444444444444444444444444444443



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 157
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-07
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-05
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]
 Score = 52.1 bits (123), Expect = 3e-09
 Identities = 23/90 (25%), Positives = 35/90 (38%), Gaps = 19/90 (21%)

Query: 16  LINLRTLDISNNKLRYLPSEIGAVKNLSPDLWQFTHLTALYMNDNNLTRLSGDISLLINL 75
             +L  L++SNNKL  LP+                 L  L  + N+L  +        NL
Sbjct: 283 PPSLEELNVSNNKLIELPALPP-------------RLERLIASFNHLAEVPELPQ---NL 326

Query: 76  RTLDISNNKLRYLPSEIGDLIYLRELCLNN 105
           + L +  N LR  P     +  LR   +N+
Sbjct: 327 KQLHVEYNPLREFPDIPESVEDLR---MNS 353


>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.75
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.73
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.72
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.71
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.7
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.68
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.67
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.63
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.59
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.58
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.56
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.55
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.55
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.54
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.51
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.5
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.5
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.47
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.44
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.44
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.4
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.38
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.37
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.06
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.04
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.9
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.75
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.63
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.63
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.5
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.42
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.3
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.09
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.96
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.75
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.4
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Slit
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=99.75  E-value=1e-17  Score=110.07  Aligned_cols=122  Identities=20%  Similarity=0.309  Sum_probs=105.0

Q ss_pred             CCCCCCccchhhhcccCCCEEEecCCccee-cCccccCCCCCChhhhcCcccceEecccCCCcccc-ccccccccccEEe
Q psy3049           2 NDNNLTRLSGDISLLINLRTLDISNNKLRY-LPSEIGAVKNLSPDLWQFTHLTALYMNDNNLTRLS-GDISLLINLRTLD   79 (157)
Q Consensus         2 ~~n~i~~l~~~~~~l~~L~~L~l~~~~l~~-~~~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~-~~~~~~~~L~~L~   79 (157)
                      +++.++.||..+.  .+++.|++++|+++. ++..         .|..+++|+.|++++|.+..++ ..+..+++|++|+
T Consensus        16 s~~~L~~iP~~lp--~~l~~L~Ls~N~i~~~~~~~---------~f~~l~~L~~L~L~~N~i~~~~~~~~~~~~~L~~L~   84 (192)
T d1w8aa_          16 TGRGLKEIPRDIP--LHTTELLLNDNELGRISSDG---------LFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQ   84 (192)
T ss_dssp             TTSCCSSCCSCCC--TTCSEEECCSCCCCSBCCSC---------SGGGCTTCCEEECCSSCCCCBCTTTTTTCTTCCEEE
T ss_pred             eCCCcCccCCCCC--CCCCEEEeCCCCCccccccc---------ccCCCceEeeeeccccccccccccccccccccceee
Confidence            6788999997763  689999999999985 4333         2667889999999999998764 5678899999999


Q ss_pred             ccCCCCCCCCh-hhhCccccceEEcCCCcccCcchh-hcCcCCCcEEEccCCCCCCh
Q psy3049          80 ISNNKLRYLPS-EIGDLIYLRELCLNNNNLRTLPYE-LGKLFQIQILGLHGNPLSKD  134 (157)
Q Consensus        80 l~~~~~~~~~~-~~~~~~~l~~l~l~~n~l~~l~~~-~~~~~~L~~l~l~~n~~~~~  134 (157)
                      +++|+++.++. .+..+++|++|++++|+++.++.. |..+++|+++++++|++.+.
T Consensus        85 Ls~N~l~~l~~~~F~~l~~L~~L~L~~N~l~~i~~~~f~~l~~L~~l~L~~N~~~~~  141 (192)
T d1w8aa_          85 LGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCN  141 (192)
T ss_dssp             CCSCCCCEECSSSSTTCTTCCEEECCSSCCCEECTTSSTTCTTCCEEECTTCCBCCS
T ss_pred             eccccccccCHHHHhCCCcccccccCCccccccCHHHhcCCcccccccccccccccc
Confidence            99999998865 678899999999999999998765 78999999999999999865



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure