Diaphorina citri psyllid: psy3051


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MNSEEFREFGKAAIDFIADYHDTVRQRQVLPSVQPGYLASLVPGEMPEEGEDWRHIMRDMNTVIMPGITHWQSPHFHAFYPSASSFPSILGELLSTGLGVLSFTWSPHVGT
ccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHccccccccccccHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccc
MNSEEFREFGKAAIDFIADYHDTVRQRQVLPSVQPGYLASLVPG*****GEDWRHIMRDMNTVIMPGITHWQSPHFHAFYPSASSFPSILGELLSTGLGVLSFTWSPH***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSEEFREFGKAAIDFIADYHDTVRQRQVLPSVQPGYLASLVPGEMPEEGEDWRHIMRDMNTVIMPGITHWQSPHFHAFYPSASSFPSILGELLSTGLGVLSFTWSPHVGT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alpha-methyldopa hypersensitive protein Participates in catecholamine metabolism. It plays a vital role in cuticle development.confidentP18486
Histidine decarboxylase confidentP23738

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:1901360 [BP]organic cyclic compound metabolic processprobableGO:0071704, GO:0008150, GO:0008152
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0016597 [MF]amino acid bindingprobableGO:0043168, GO:0003674, GO:0031406, GO:0005488, GO:0043167
GO:0046483 [BP]heterocycle metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0019239 [MF]deaminase activityprobableGO:0003824, GO:0003674
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0016831 [MF]carboxy-lyase activityprobableGO:0003824, GO:0016829, GO:0016830, GO:0003674
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0034641 [BP]cellular nitrogen compound metabolic processprobableGO:0009987, GO:0006807, GO:0008150, GO:0008152, GO:0044237
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0006725 [BP]cellular aromatic compound metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:1901605 [BP]alpha-amino acid metabolic processprobableGO:0044238, GO:0044710, GO:0009987, GO:1901564, GO:0006082, GO:0044237, GO:0006520, GO:0019752, GO:0071704, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0043436
GO:0050896 [BP]response to stimulusprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K40, chain A
Confidence level:very confident
Coverage over the Query: 1-110
View the alignment between query and template
View the model in PyMOL