Diaphorina citri psyllid: psy3088


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
IASQYHPDKNPGGRDIFVRANKAYDFLCSRTCWQNNDPNPNNIVLVLRTQSILFHRYSEELSGYKYAGYRQLITTIRAETSDENEALFGGSTEHDSLLQAAVELAYHTVQCSALNAQELNNEGGF
ccccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHcHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHccccccccHHHHHHHHHHHHHHHHcccccHHHHHHcccc
IASQYHPDKNPGGRDIFVRANKAYDFLCSRTCWQNNDPNPNNIVLVLRTQSILFHRYSEELSGYKYAGYRQLITTIRAETSDENEALFGGSTEHDSLLQAAVELAYHTVQCSALNAQELNNEG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IASQYHPDKNPGGRDIFVRANKAYDFLCSRTCWQNNDPNPNNIVLVLRTQSILFHRYSEELSGYKYAGYRQLITTIRAETSDENEALFGGSTEHDSLLQAAVELAYHTVQCSALNAQELNNEGGF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DnaJ homolog subfamily C member 13 confidentO75165

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005770 [CC]late endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0055037 [CC]recycling endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0010008 [CC]endosome membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005768, GO:0043226, GO:0044422, GO:0043231
GO:0031201 [CC]SNARE complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425
GO:0005769 [CC]early endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CTQ, chain A
Confidence level:confident
Coverage over the Query: 1-33,52-70
View the alignment between query and template
View the model in PyMOL