Psyllid ID: psy3088

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
IASQYHPDKNPGGRDIFVRANKAYDFLCSRTCWQNNDPNPNNIVLVLRTQSILFHRYSEELSGYKYAGYRQLITTIRAETSDENEALFGGSTEHDSLLQAAVELAYHTVQCSALNAQELNNEGGF
ccccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHcHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHHHHHHcccccHHHHHHcccc
ccHHHcccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHEEcccccHHHHccccccccccHHHHHHHHHHHHHHccHccHHHHHHcccc
iasqyhpdknpggrdIFVRANKAYDFLCsrtcwqnndpnpnnIVLVLRTQSILFHRYSeelsgykyaGYRQLITTIRAetsdenealfggsteHDSLLQAAVELAYHTVQCSALNAQELNNEGGF
iasqyhpdknpggrdIFVRANKAYDFLCSRTCWQNNDPNPNNIVLVLRTQSILFHRYSEelsgykyaGYRQLITTIRAETSDENEALFGGSTEHDSLLQAAVELAYHTVQCSALNAQELNNEGGF
IASQYHPDKNPGGRDIFVRANKAYDFLCSRTCWQNNDPNPNNIVLVLRTQSILFHRYSEELSGYKYAGYRQLITTIRAETSDENEALFGGSTEHDSLLQAAVELAYHTVQCSALNAQELNNEGGF
**************DIFVRANKAYDFLCSRTCWQNNDPNPNNIVLVLRTQSILFHRYSEELSGYKYAGYRQLITTIRAET*****ALFGGSTEHDSLLQAAVELAYHTVQCSAL***********
IASQYHPDKNPGGRDIFVRANKAYDFLC***************VLVLRTQSILFHRYSEELSGYKYAGYRQLITTIRAETSDENEALFGGSTEHDSLLQAAVELAYHTVQCSALNAQELNNEG**
IASQYHPDKNPGGRDIFVRANKAYDFLCSRTCWQNNDPNPNNIVLVLRTQSILFHRYSEELSGYKYAGYRQLITTIRAETSDENEALFGGSTEHDSLLQAAVELAYHTVQCSALNAQELNNEGGF
IASQYHPDKNPGGRDIFVRANKAYDFLCSRTCWQNNDPNPNNIVLVLRTQSILFHRYSEELSGYKYAGYRQLITTIRAETSDENEALFGGSTEHDSLLQAAVELAYHTVQCSALNAQELNN****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IASQYHPDKNPGGRDIFVRANKAYDFLCSRTCWQNNDPNPNNIVLVLRTQSILFHRYSEELSGYKYAGYRQLITTIRAETSDENEALFGGSTEHDSLLQAAVELAYHTVQCSALNAQELNNEGGF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query125 2.2.26 [Sep-21-2011]
O75165 2243 DnaJ homolog subfamily C yes N/A 0.96 0.053 0.56 1e-34
F4IVL6 2554 DnaJ homolog subfamily C yes N/A 0.952 0.046 0.388 5e-17
>sp|O75165|DJC13_HUMAN DnaJ homolog subfamily C member 13 OS=Homo sapiens GN=DNAJC13 PE=1 SV=5 Back     alignment and function desciption
 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 91/125 (72%), Gaps = 5/125 (4%)

Query: 1    IASQYHPDKNPGGRDIFVRANKAYDFLCSRTCWQNNDPNPNNIVLVLRTQSILFHRYSEE 60
            +A +YHPDKNP GRD+F + NKAY+FLC+++    + P+P NI+L+L+TQSILF+R+ E+
Sbjct: 1327 LAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSAKIVDGPDPENIILILKTQSILFNRHKED 1386

Query: 61   LSGYKYAGYRQLITTIRAETSDENEALFGGSTEHDSLLQAAVELAYHTVQCSALNAQELN 120
            L  YKYAGY  LI TI  ETSD  + LF   ++   LL AA ELA+HTV CSALNA+EL 
Sbjct: 1387 LQPYKYAGYPMLIRTITMETSD--DLLF---SKESPLLPAATELAFHTVNCSALNAEELR 1441

Query: 121  NEGGF 125
             E G 
Sbjct: 1442 RENGL 1446

Homo sapiens (taxid: 9606)
>sp|F4IVL6|GRV2_ARATH DnaJ homolog subfamily C GRV2 OS=Arabidopsis thaliana GN=GRV2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
340714477 2231 PREDICTED: dnaJ homolog subfamily C memb 0.96 0.053 0.664 6e-41
380011445 2231 PREDICTED: dnaJ homolog subfamily C memb 0.96 0.053 0.664 7e-41
350411166 2231 PREDICTED: dnaJ homolog subfamily C memb 0.96 0.053 0.664 7e-41
328776605 2231 PREDICTED: dnaJ homolog subfamily C memb 0.96 0.053 0.664 7e-41
383859340 2231 PREDICTED: dnaJ homolog subfamily C memb 0.96 0.053 0.656 1e-40
307189712 2255 DnaJ-like protein subfamily C member 13 0.96 0.053 0.648 8e-40
307194623 2229 DnaJ-like protein subfamily C member 13 0.96 0.053 0.648 9e-40
328707311 2227 PREDICTED: dnaJ homolog subfamily C memb 0.96 0.053 0.648 9e-40
328707309 2223 PREDICTED: dnaJ homolog subfamily C memb 0.96 0.053 0.648 9e-40
345495329 2094 PREDICTED: LOW QUALITY PROTEIN: dnaJ hom 0.96 0.057 0.632 2e-39
>gi|340714477|ref|XP_003395755.1| PREDICTED: dnaJ homolog subfamily C member 13-like [Bombus terrestris] Back     alignment and taxonomy information
 Score =  171 bits (432), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 93/125 (74%), Gaps = 5/125 (4%)

Query: 1    IASQYHPDKNPGGRDIFVRANKAYDFLCSRTCWQNNDPNPNNIVLVLRTQSILFHRYSEE 60
            +A  YHPDKNP GRD F   N+AY+FLCSR+CW  + PNP+NIVL+LRTQSILFHRYS+E
Sbjct: 1318 LAQMYHPDKNPQGRDKFEAVNQAYEFLCSRSCWSTDGPNPDNIVLILRTQSILFHRYSDE 1377

Query: 61   LSGYKYAGYRQLITTIRAETSDENEALFGGSTEHDSLLQAAVELAYHTVQCSALNAQELN 120
            L  YKYAGY QLI TI+ ET DE   LF  S     LL AA ELAYHTV CSALNA+EL 
Sbjct: 1378 LRPYKYAGYPQLIKTIKLETDDEQ--LFSKSA---PLLAAASELAYHTVHCSALNAEELR 1432

Query: 121  NEGGF 125
             EGG 
Sbjct: 1433 REGGL 1437

Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380011445|ref|XP_003689816.1| PREDICTED: dnaJ homolog subfamily C member 13 [Apis florea] Back     alignment and taxonomy information
>gi|350411166|ref|XP_003489260.1| PREDICTED: dnaJ homolog subfamily C member 13-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328776605|ref|XP_394533.4| PREDICTED: dnaJ homolog subfamily C member 13 [Apis mellifera] Back     alignment and taxonomy information
>gi|383859340|ref|XP_003705153.1| PREDICTED: dnaJ homolog subfamily C member 13 [Megachile rotundata] Back     alignment and taxonomy information
>gi|307189712|gb|EFN74007.1| DnaJ-like protein subfamily C member 13 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307194623|gb|EFN76912.1| DnaJ-like protein subfamily C member 13 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328707311|ref|XP_003243359.1| PREDICTED: dnaJ homolog subfamily C member 13 isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328707309|ref|XP_001949942.2| PREDICTED: dnaJ homolog subfamily C member 13 isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|345495329|ref|XP_003427483.1| PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog subfamily C member 13-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
FB|FBgn0015477 2408 Rme-8 "Receptor mediated endoc 0.952 0.049 0.612 1.1e-33
WB|WBGene00004378 2279 rme-8 [Caenorhabditis elegans 0.96 0.052 0.508 1.1e-24
TAIR|locus:2039543 2554 GRV2 "GRAVITROPISM DEFECTIVE 2 0.944 0.046 0.4 4e-16
DICTYBASE|DDB_G0286293 2592 dnajc13 "DnaJ (Hsp40) homolog, 0.968 0.046 0.338 1.2e-11
FB|FBgn0015477 Rme-8 "Receptor mediated endocytosis 8" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 383 (139.9 bits), Expect = 1.1e-33, P = 1.1e-33
 Identities = 76/124 (61%), Positives = 88/124 (70%)

Query:     1 IASQYHPDKNPGGRDIFVRANKAYDFLCSRTCWQNNDPNPNNIVLVLRTQSILFHRYSEE 60
             +A  YHPDKNP GR+IF + N+AY+FLCSR  W +  P+PNNIVL+LRTQSILF RY + 
Sbjct:  1329 LAQMYHPDKNPNGREIFEKVNQAYEFLCSRNVWSSGGPDPNNIVLILRTQSILFERYPDV 1388

Query:    61 LSGYKYAGYRQLITTIRAETSDENEALFGGSTEHDSLLQAAVELAYHTVQCSALNAQELN 120
             L  YKYAGY QLI TIR ET D+   LF    +   LL AA EL YHTV CSALNA+EL 
Sbjct:  1389 LRPYKYAGYPQLIKTIRLETRDDE--LFSKEAQ---LLTAASELCYHTVHCSALNAEELR 1443

Query:   121 NEGG 124
              E G
Sbjct:  1444 REEG 1447
GO:0006897 "endocytosis" evidence=NAS
GO:0006898 "receptor-mediated endocytosis" evidence=IMP
GO:0007298 "border follicle cell migration" evidence=IMP
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0031201 "SNARE complex" evidence=IDA
WB|WBGene00004378 rme-8 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TAIR|locus:2039543 GRV2 "GRAVITROPISM DEFECTIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286293 dnajc13 "DnaJ (Hsp40) homolog, subfamily C, member 13" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O75165DJC13_HUMANNo assigned EC number0.560.960.0534yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 3e-04
pfam0022663 pfam00226, DnaJ, DnaJ domain 5e-04
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 8e-04
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 0.001
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 0.001
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 0.002
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information 
 Score = 36.1 bits (84), Expect = 3e-04
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 4/31 (12%)

Query: 2  ASQYHPDKNPGGR----DIFVRANKAYDFLC 28
          A +YHPDKNPG +    + F   N+AY+ L 
Sbjct: 26 ALKYHPDKNPGDKEEAEEKFKEINEAYEVLS 56

Length = 60
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 125
KOG1789|consensus 2235 100.0
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.52
KOG0717|consensus 508 99.48
KOG0712|consensus 337 99.48
KOG0713|consensus 336 99.39
PRK14288 369 chaperone protein DnaJ; Provisional 99.26
PRK14296 372 chaperone protein DnaJ; Provisional 99.26
PRK14279 392 chaperone protein DnaJ; Provisional 99.18
PRK14286 372 chaperone protein DnaJ; Provisional 99.16
PRK14287 371 chaperone protein DnaJ; Provisional 99.13
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.12
PRK14276 380 chaperone protein DnaJ; Provisional 99.11
PRK14283 378 chaperone protein DnaJ; Provisional 99.1
PRK14285 365 chaperone protein DnaJ; Provisional 99.09
PRK14277 386 chaperone protein DnaJ; Provisional 99.09
PRK14278 378 chaperone protein DnaJ; Provisional 99.09
PRK14282 369 chaperone protein DnaJ; Provisional 99.09
PRK14298 377 chaperone protein DnaJ; Provisional 99.09
PRK14280 376 chaperone protein DnaJ; Provisional 99.08
PRK14297 380 chaperone protein DnaJ; Provisional 99.07
PRK14301 373 chaperone protein DnaJ; Provisional 99.04
PRK14291 382 chaperone protein DnaJ; Provisional 99.04
PRK14284 391 chaperone protein DnaJ; Provisional 99.04
PRK14294 366 chaperone protein DnaJ; Provisional 99.04
PRK14299 291 chaperone protein DnaJ; Provisional 99.04
PRK14281 397 chaperone protein DnaJ; Provisional 98.99
KOG0716|consensus 279 98.97
PRK10767 371 chaperone protein DnaJ; Provisional 98.96
PRK14295 389 chaperone protein DnaJ; Provisional 98.96
KOG0691|consensus 296 98.95
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 98.92
PRK14289 386 chaperone protein DnaJ; Provisional 98.91
PRK14292 371 chaperone protein DnaJ; Provisional 98.91
PRK14290 365 chaperone protein DnaJ; Provisional 98.91
PRK14300 372 chaperone protein DnaJ; Provisional 98.89
KOG0715|consensus288 98.87
PRK14293 374 chaperone protein DnaJ; Provisional 98.85
PRK10266 306 curved DNA-binding protein CbpA; Provisional 98.83
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 98.77
KOG0719|consensus 264 98.65
KOG0718|consensus 546 98.64
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 98.54
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 98.54
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 98.53
PHA03102153 Small T antigen; Reviewed 98.5
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 98.49
KOG0714|consensus 306 98.39
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 98.24
KOG0721|consensus230 98.08
PRK05014171 hscB co-chaperone HscB; Provisional 98.05
PRK01356166 hscB co-chaperone HscB; Provisional 98.03
PRK00294173 hscB co-chaperone HscB; Provisional 98.0
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.0
PRK03578176 hscB co-chaperone HscB; Provisional 97.84
PHA02624 647 large T antigen; Provisional 97.57
KOG0722|consensus 329 97.49
KOG0720|consensus 490 97.36
KOG0550|consensus486 97.12
KOG0624|consensus504 97.08
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 96.94
PRK01773173 hscB co-chaperone HscB; Provisional 96.46
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 95.8
KOG1150|consensus250 94.14
KOG0568|consensus 342 85.06
>KOG1789|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.2e-43  Score=326.74  Aligned_cols=121  Identities=55%  Similarity=0.874  Sum_probs=117.4

Q ss_pred             CcchhCCCCCCCHHHHHHHHHHHHHHhcccccccCCCCCChhHHHHHhhhHHHhhhhhhhcccccchhhHHHHHHHHhhc
Q psy3088           1 IASQYHPDKNPGGRDIFVRANKAYDFLCSRTCWQNNDPNPNNIVLVLRTQSILFHRYSEELSGYKYAGYRQLITTIRAET   80 (125)
Q Consensus         1 LA~kyHPDkNp~~~ekFk~I~~AYevLsd~~~r~~~gpd~~~~~l~L~~q~~~Y~ryg~~l~~~kyagy~~l~~~i~~e~   80 (125)
                      ||+||||||||++++||..|++|||.|+.......+|||||||.++||+|||+|.|||++|+||||||||||++||++|+
T Consensus      1309 LA~kYHPDKNPEGRemFe~VnKAYE~L~~~ta~~~~GPdP~riiL~LKaQsILy~Ry~~~L~PyKYAGYPMLi~tiT~e~ 1388 (2235)
T KOG1789|consen 1309 LAAKYHPDKNPEGREMFERVNKAYELLSSETANNSGGPDPHRIVLCLKAQSILYSRYSQELSPYKYAGYPMLIKTITLEA 1388 (2235)
T ss_pred             HHHHhCCCCCchHHHHHHHHHHHHHHHHHHHhhcCCCCChhHhhHHHHhHHHHHHHhhhhcCccccCcchhhhhhhhhcc
Confidence            58899999999999999999999999999888889999999999999999999999999999999999999999999999


Q ss_pred             cchhhhhcCCCCCcchhHHHHHHHHHHHhhhcccCHHHHHhcCCC
Q psy3088          81 SDENEALFGGSTEHDSLLQAAVELAYHTVQCSALNAQELNNEGGF  125 (125)
Q Consensus        81 ~d~~~~lf~~~~~~~~ll~~a~eL~~~T~~~s~lNaeel~r~~g~  125 (125)
                      +|+  .||||+  +.|||+||+||+.+||.||+||||||+|+||+
T Consensus      1389 ~D~--~lfSk~--~~PLL~AA~ELa~~T~~~SaLNaEELrRdnGl 1429 (2235)
T KOG1789|consen 1389 KDE--ALFSKG--GGPLLSAAIELANYTLISSALNAEELRRDNGL 1429 (2235)
T ss_pred             cch--hhhcCC--CCcchHHHHHHHHHHHhhhhcCHHHHhhcccH
Confidence            999  999987  47999999999999999999999999999996

>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0717|consensus Back     alignment and domain information
>KOG0712|consensus Back     alignment and domain information
>KOG0713|consensus Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716|consensus Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691|consensus Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715|consensus Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0719|consensus Back     alignment and domain information
>KOG0718|consensus Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>KOG0714|consensus Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0721|consensus Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG0722|consensus Back     alignment and domain information
>KOG0720|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1150|consensus Back     alignment and domain information
>KOG0568|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 2e-05
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 3e-05
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 5e-04
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 5e-04
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 7e-04
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 7e-04
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 9e-04
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
 Score = 39.6 bits (93), Expect = 2e-05
 Identities = 10/26 (38%), Positives = 16/26 (61%)

Query: 2  ASQYHPDKNPGGRDIFVRANKAYDFL 27
          A +YHPDK  G  + F   ++A++ L
Sbjct: 33 ALKYHPDKPTGDTEKFKEISEAFEIL 58
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.27
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.16
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.13
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.11
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.1
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.09
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.09
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.07
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.03
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.03
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.02
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.01
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 98.97
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 98.96
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 98.96
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 98.96
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 98.96
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 98.93
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 98.92
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 98.89
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 98.82
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 98.78
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 98.74
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 98.72
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 98.68
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 98.59
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 98.59
2guz_A71 Mitochondrial import inner membrane translocase su 98.58
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 98.54
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 98.52
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 94.9
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 90.63
2guz_B65 Mitochondrial import inner membrane translocase su 85.12
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 82.87
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
Probab=99.27  E-value=1.2e-12  Score=85.58  Aligned_cols=42  Identities=33%  Similarity=0.657  Sum_probs=36.5

Q ss_pred             CcchhCCCCCCCHHHHHHHHHHHHHHhcccccccCCCCCChhHHHHHhhhHHHhhhhhhh
Q psy3088           1 IASQYHPDKNPGGRDIFVRANKAYDFLCSRTCWQNNDPNPNNIVLVLRTQSILFHRYSEE   60 (125)
Q Consensus         1 LA~kyHPDkNp~~~ekFk~I~~AYevLsd~~~r~~~gpd~~~~~l~L~~q~~~Y~ryg~~   60 (125)
                      |+++||||++++..++|++|++||+||+|+.+|                  ..||++|++
T Consensus        32 l~~~~HPD~~~~~~~~f~~i~~Ay~~L~d~~~R------------------~~YD~~g~~   73 (73)
T 2och_A           32 MALKFHPDKNPDGAEQFKQISQAYEVLSDEKKR------------------QIYDQGGEE   73 (73)
T ss_dssp             HHHHTCTTTCTTCHHHHHHHHHHHHHHTSHHHH------------------HHHHHTC--
T ss_pred             HHHHHCcCCCcCHHHHHHHHHHHHHHHCCHHHH------------------HHHHhcCCC
Confidence            478999999998889999999999999999876                  579999863
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.2
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.16
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 98.9
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 98.64
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 98.6
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 98.59
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 98.49
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.20  E-value=2.7e-12  Score=83.89  Aligned_cols=42  Identities=29%  Similarity=0.601  Sum_probs=36.2

Q ss_pred             CcchhCCCCCCC---HHHHHHHHHHHHHHhcccccccCCCCCChhHHHHHhhhHHHhhhhhhh
Q psy3088           1 IASQYHPDKNPG---GRDIFVRANKAYDFLCSRTCWQNNDPNPNNIVLVLRTQSILFHRYSEE   60 (125)
Q Consensus         1 LA~kyHPDkNp~---~~ekFk~I~~AYevLsd~~~r~~~gpd~~~~~l~L~~q~~~Y~ryg~~   60 (125)
                      |+++||||+|++   ..++|++|++||+||+||.+|                  ..||+||..
T Consensus        27 l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R------------------~~YD~~g~~   71 (75)
T d1xbla_          27 LAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKR------------------AAYDQYGHA   71 (75)
T ss_dssp             HHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHH------------------HHHHHHTTS
T ss_pred             HHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHH------------------HHHHHhCcc
Confidence            478999999874   467899999999999999877                  589999964
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure