Diaphorina citri psyllid: psy3095


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MEVKVQPHYEGPFPCDLSQARSPLPPNNVNQLRPGDIDIVGAIGDSITAGNGIVATNPSQVNTENRGLSWSVGKNFGPARRRPANHYQVELISHTCQVYLIVCVLI
ccEEccccccccccccccccccccccccccccccccccEEEEcccHHHHcccccccccccccccccccEEEccccccccccccccccccccEEEEcccEEEEEEEc
***********PFPC*L*************QLRPGDIDIVGAIGDSITAGNGIVATNPSQVNTENRGLSWSVGKNFGPARRRPANHYQVELISHTCQVYLIVCVLI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVKVQPHYEGPFPCDLSQARSPLPPNNVNQLRPGDIDIVGAIGDSITAGNGIVATNPSQVNTENRGLSWSVGKNFGPARRRPANHYQVELISHTCQVYLIVCVLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phospholipase B1, membrane-associated Membrane-associated phospholipase. Exhibits a calcium-independent broad substrate specificity including phospholipase A2/lysophospholipase activity. Can convert phosphatidylcholine to fatty acids and glycerophosphocholine. Could be involved in uptake of dietary lipids, possibly including long chain retinyl esters.confidentQ05017
Phospholipase B1, membrane-associated Membrane-associated phospholipase. Exhibits a calcium-independent broad substrate specificity including phospholipase A2/lysophospholipase activity. Preferential hydrolysis at the sn-2 position of diacylphospholipids and diacyglycerol, whereas it shows no positional specificity toward triacylglycerol. Exhibits also esterase activity toward p-nitrophenyl. May act on the brush border membrane to facilitate the absorption of digested lipids.confidentO70320
Phospholipase B1, membrane-associated Membrane-associated phospholipase. Exhibits a calcium-independent broad substrate specificity including phospholipase A2/lysophospholipase activity. Preferential hydrolysis at the sn-2 position of diacylphospholipids and diacyglycerol, whereas it shows no positional specificity toward triacylglycerol. Exhibits also esterase activity toward p-nitrophenyl. May act on the brush border membrane to facilitate the absorption of digested lipids.confidentO54728

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DC7, chain A
Confidence level:probable
Coverage over the Query: 38-75
View the alignment between query and template
View the model in PyMOL