Diaphorina citri psyllid: psy3140


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MTAIESFVTSIDEKTVDREKTCPLLLRVFTNFGKHNNVSDFHNGFPPNQLQIYTWMDATLRELTNLIREVNPEAQQRGTCFYFTLLTPERGTSRFHVRDIGQTICGQKGPDDNKTLQQCRFIIGDYMDVKILTPKRNR
ccccccccccccccccccccccccEEEEEEcccccccccccccccccccEEEEEcccccHHHHHHHHHHHcccccccccEEEEEEEEcccccccEEEEEEEEEECccccccccccccccccccccEEEEEECcccccc
**********I**KTVDREKTCPLLLRVFTNFGKHNNVSDFHNGFPPNQLQIYTWMDATLRELTNLIREVNPEAQQRGTCFYFTLLTPERGTSRFHVRDIGQTICGQKGPDDNKTLQQCRFIIGDYMDVKILTPK***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTAIESFVTSIDEKTVDREKTCPLLLRVFTNFGKHNNVSDFHNGFPPNQLQIYTWMDATLRELTNLIREVNPEAQQRGTCFYFTLLTPERGTSRFHVRDIGQTICGQKGPDDNKTLQQCRFIIGDYMDVKILTPKRNR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histone deacetylase complex subunit SAP18 Component of the SIN3-repressing complex. Enhances the ability of SIN3-HDAC1-mediated transcriptional repression. When tethered to the promoter, it can direct the formation of a repressive complex to core histone proteins. Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism.very confidentQ5RDT5
Probable histone deacetylase complex subunit SAP18 Acts in transcription repression. Involved in the tethering of the SIN3 complex to core histone proteins.very confidentQ09250
Histone deacetylase complex subunit SAP18 Involved in the tethering of the SIN3 complex to core histone proteins. Interacts with bicoid (bcd) to repress transcription of bicoid target genes in the anterior tip of the embryo; a process known as retraction. Interacts with Trl and binds to Polycomb response elements at the bithorax complex. May contribute to the regulation of other homeotic gene expressions.very confidentQ9VEX9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusconfidentGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0071011 [CC]precatalytic spliceosomeconfidentGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0005886 [CC]plasma membraneconfidentGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0071013 [CC]catalytic step 2 spliceosomeconfidentGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0003714 [MF]transcription corepressor activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0006342 [BP]chromatin silencingprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0040029, GO:0010629, GO:0050789, GO:0044699, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0008150, GO:0060255, GO:0016458, GO:0065007, GO:0048519, GO:0045814, GO:0010468, GO:0045934, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0044763, GO:0010558, GO:0048523
GO:0008134 [MF]transcription factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0000398 [BP]mRNA splicing, via spliceosomeprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0016580 [CC]Sin3 complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0070822, GO:0031981, GO:0005634, GO:0005654, GO:0044454, GO:0044451, GO:0005694, GO:0000118, GO:0000790, GO:0043231, GO:0043234, GO:0032991, GO:0005575, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A6Q, chain A
Confidence level:very confident
Coverage over the Query: 11-137
View the alignment between query and template
View the model in PyMOL