Diaphorina citri psyllid: psy3143

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------

DDSSDEEGNKEDKEDNEGSEEDDVDAEEDFALPDDEMKHDNIKNRQKLIGKKKQKRLAKEGKLKQVEAEEYEENEGGKEFFEDAPPVEENSSFHQMNLSRPLLKAIGALNYIYPTPIQAATIPVALLGRDICGCAATGTGKTAAFMLPILERLLYKPRDDQNTRVLVLVPTRELGVQVYQVTRQLAQFTSVEVALSVGGLEVKVQESVLRKCPDIVIATPGRLLDHLHNTPSFSLSDIEVLVLDEADRMLDEHFASQMKEIIRLCSRTRQTMLFSATMTDAVNDLVSVSLTRPVRVFVDNNHEVALNLRQEFVSFSNIDEVRLYNVLGLMLLRENCL

ccccccccccccccccccccccccccHcccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHcccccccHHHHcHHHHHHccccEEEEccccccHHHHHHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHccccEEEEcccHHHHHHcccccccccccEEEEEEccccccccccHHHHHHHHHHccccccccEEEccccHHHHHHHHHHcccccEEEEccccccccccEEEEEEEccccHHHHHHHHHHHHHccccc

********************************************************************************************FHQMNLSRPLLKAIGALNYIYPTPIQAATIPVALLGRDICGCAATGTGKTAAFMLPILERLLYKPRDDQNTRVLVLVPTRELGVQVYQVTRQLAQFTSVEVALSVGGLEVKVQESVLRKCPDIVIATPGRLLDHLHNTPSFSLSDIEVLVLDEADRMLDEHFASQMKEIIRLCSRTRQTMLFSATMTDAVNDLVSVSLTRPVRVFVDNNHEVALNLRQEFVSFSNIDEVRLYNVLGLMLLRENCL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable ATP-dependent RNA helicase DDX27	Probable ATP-dependent RNA helicase.	confident	Q96GQ7
ATP-dependent RNA helicase drs1	ATP-binding RNA helicase involved in ribosome assembly.	confident	Q2UQI6
Probable ATP-dependent RNA helicase DDX27	Probable ATP-dependent RNA helicase.	confident	A1A4H6

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0030687 [CC]	preribosome, large subunit precursor	probable	GO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0044763 [BP]	single-organism cellular process	probable	GO:0009987, GO:0008150, GO:0044699
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0010494 [CC]	cytoplasmic stress granule	probable	GO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0004004 [MF]	ATP-dependent RNA helicase activity	probable	GO:0016787, GO:0016818, GO:0008026, GO:0042623, GO:0003824, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0003724, GO:0003674, GO:0016887, GO:0008186, GO:0016462
GO:0006396 [BP]	RNA processing	probable	GO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0022613 [BP]	ribonucleoprotein complex biogenesis	probable	GO:0044085, GO:0008150, GO:0071840
GO:0003723 [MF]	RNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PL3, chain A
Confidence level:very confident
Coverage over the Query: 88-300
View the alignment between query and template
View the model in PyMOL

Template: 3FHT, chain A
Confidence level:very confident
Coverage over the Query: 84-332
View the alignment between query and template
View the model in PyMOL