Diaphorina citri psyllid: psy3162


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MPKPQPTKSFLGLYCGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRGSGPQPGEEMLPEVA
cccccccccccccccccEEccccccEEEEEEEEEccccccEEEEEEEEEEEccccEEEEEcEEEEcccCECcccccccccccccccccccc
******T*SFLGLYCGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTP*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPKPQPTKSFLGLYCGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRGSGPQPGEEMLPEVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin carboxyl-terminal hydrolase 5 Cleaves linear and branched multiubiquitin polymers with a marked preference for branched polymers. Involved in unanchored 'Lys-48'-linked polyubiquitin disassembly. Binds linear and 'Lys-63'-linked polyubiquitin with a lower affinity. Knock-down of USP5 causes the accumulation of p53/TP53 and an increase in p53/TP53 transcriptional activity because the unanchored polyubiquitin that accumulates is able to compete with ubiquitinated p53/TP53 but not with MDM2 for proteasomal recognition.confidentP45974
Ubiquitin carboxyl-terminal hydrolase 5 Cleaves linear and branched multiubiquitin polymers with a marked preference for branched polymers. Involved in unanchored 'Lys-48'-linked polyubiquitin disassembly. Binds linear and 'Lys-63'-linked polyubiquitin with a lower affinity.confidentP56399
Ubiquitin carboxyl-terminal hydrolase 5 Cleaves linear and branched multiubiquitin polymers with a marked preference for branched polymers. Involved in unanchored 'Lys-48'-linked polyubiquitin disassembly. Binds linear and 'Lys-63'-linked polyubiquitin with a lower affinity.confidentQ5R407

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0060255 [BP]regulation of macromolecule metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0016579 [BP]protein deubiquitinationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0070646, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0031329 [BP]regulation of cellular catabolic processprobableGO:0009894, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0008150, GO:0050789

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IHP, chain A
Confidence level:very confident
Coverage over the Query: 5-90
View the alignment between query and template
View the model in PyMOL