Psyllid ID: psy3162
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 91 | ||||||
| 322801464 | 818 | hypothetical protein SINV_08392 [Solenop | 0.670 | 0.074 | 0.737 | 5e-19 | |
| 307174012 | 799 | Ubiquitin carboxyl-terminal hydrolase 5 | 0.648 | 0.073 | 0.762 | 6e-19 | |
| 332019367 | 803 | Ubiquitin carboxyl-terminal hydrolase 5 | 0.670 | 0.075 | 0.737 | 2e-18 | |
| 340714339 | 810 | PREDICTED: ubiquitin carboxyl-terminal h | 0.747 | 0.083 | 0.661 | 5e-18 | |
| 340714337 | 802 | PREDICTED: ubiquitin carboxyl-terminal h | 0.747 | 0.084 | 0.661 | 6e-18 | |
| 350417343 | 802 | PREDICTED: ubiquitin carboxyl-terminal h | 0.747 | 0.084 | 0.661 | 6e-18 | |
| 380025673 | 805 | PREDICTED: LOW QUALITY PROTEIN: ubiquiti | 0.747 | 0.084 | 0.647 | 1e-17 | |
| 156543203 | 799 | PREDICTED: ubiquitin carboxyl-terminal h | 0.747 | 0.085 | 0.676 | 1e-17 | |
| 307192538 | 806 | Ubiquitin carboxyl-terminal hydrolase 5 | 0.747 | 0.084 | 0.647 | 2e-17 | |
| 328788537 | 802 | PREDICTED: ubiquitin carboxyl-terminal h | 0.747 | 0.084 | 0.647 | 4e-17 |
| >gi|322801464|gb|EFZ22125.1| hypothetical protein SINV_08392 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Score = 98.6 bits (244), Expect = 5e-19, Method: Compositional matrix adjust.
Identities = 45/61 (73%), Positives = 54/61 (88%)
Query: 31 RTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRGSGPQPGEEMLPEV 90
+TTRLASFPDYL+ HLKKFT+KEDWT KLDV +EMPDT+DL+ LRG+G QPGEE+LP+
Sbjct: 563 KTTRLASFPDYLLIHLKKFTVKEDWTPIKLDVAIEMPDTVDLSFLRGNGLQPGEELLPDG 622
Query: 91 A 91
A
Sbjct: 623 A 623
|
Source: Solenopsis invicta Species: Solenopsis invicta Genus: Solenopsis Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307174012|gb|EFN64722.1| Ubiquitin carboxyl-terminal hydrolase 5 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332019367|gb|EGI59868.1| Ubiquitin carboxyl-terminal hydrolase 5 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|340714339|ref|XP_003395687.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 5-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|340714337|ref|XP_003395686.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 5-like isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350417343|ref|XP_003491376.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 5-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|380025673|ref|XP_003696593.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 5-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|156543203|ref|XP_001606298.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 5-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|307192538|gb|EFN75726.1| Ubiquitin carboxyl-terminal hydrolase 5 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|328788537|ref|XP_624702.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase 5-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 91 | ||||||
| UNIPROTKB|F1N3P2 | 858 | USP5 "Ubiquitin carboxyl-termi | 0.681 | 0.072 | 0.580 | 4e-15 | |
| UNIPROTKB|P45974 | 858 | USP5 "Ubiquitin carboxyl-termi | 0.681 | 0.072 | 0.580 | 4e-15 | |
| MGI|MGI:1347343 | 858 | Usp5 "ubiquitin specific pepti | 0.681 | 0.072 | 0.580 | 4e-15 | |
| RGD|1308438 | 858 | Usp5 "ubiquitin specific pepti | 0.681 | 0.072 | 0.580 | 4e-15 | |
| UNIPROTKB|F1SLU6 | 859 | USP5 "Ubiquitin carboxyl-termi | 0.681 | 0.072 | 0.580 | 4e-15 | |
| UNIPROTKB|F1P9P5 | 868 | USP5 "Ubiquitin carboxyl-termi | 0.681 | 0.071 | 0.580 | 4e-15 | |
| TAIR|locus:2083440 | 797 | UBP14 "ubiquitin-specific prot | 0.747 | 0.085 | 0.5 | 2e-14 | |
| UNIPROTKB|E1C8W4 | 833 | USP5 "Ubiquitin carboxyl-termi | 0.681 | 0.074 | 0.548 | 5.7e-14 | |
| UNIPROTKB|H7C5J3 | 299 | USP13 "Ubiquitin carboxyl-term | 0.769 | 0.234 | 0.471 | 1.3e-13 | |
| UNIPROTKB|F1SGC5 | 436 | USP13 "Uncharacterized protein | 0.769 | 0.160 | 0.471 | 4.6e-13 |
| UNIPROTKB|F1N3P2 USP5 "Ubiquitin carboxyl-terminal hydrolase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 203 (76.5 bits), Expect = 4.0e-15, P = 4.0e-15
Identities = 36/62 (58%), Positives = 48/62 (77%)
Query: 30 LRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRGSGPQPGEEMLPE 89
++TTR ASFPDYL+ +KKFT DW KLDV +EMP+ +D++ LRG+G QPGEE LP+
Sbjct: 557 VKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDISQLRGTGLQPGEEELPD 616
Query: 90 VA 91
+A
Sbjct: 617 IA 618
|
|
| UNIPROTKB|P45974 USP5 "Ubiquitin carboxyl-terminal hydrolase 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1347343 Usp5 "ubiquitin specific peptidase 5 (isopeptidase T)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1308438 Usp5 "ubiquitin specific peptidase 5 (isopeptidase T)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SLU6 USP5 "Ubiquitin carboxyl-terminal hydrolase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P9P5 USP5 "Ubiquitin carboxyl-terminal hydrolase" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2083440 UBP14 "ubiquitin-specific protease 14" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C8W4 USP5 "Ubiquitin carboxyl-terminal hydrolase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H7C5J3 USP13 "Ubiquitin carboxyl-terminal hydrolase 13" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SGC5 USP13 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 91 | |||
| cd02658 | 311 | cd02658, Peptidase_C19B, A subfamily of Peptidase | 1e-12 | |
| cd02257 | 255 | cd02257, Peptidase_C19, Peptidase C19 contains ubi | 3e-10 | |
| pfam00443 | 313 | pfam00443, UCH, Ubiquitin carboxyl-terminal hydrol | 4e-10 | |
| cd02660 | 328 | cd02660, Peptidase_C19D, A subfamily of Peptidase | 0.002 |
| >gnl|CDD|239123 cd02658, Peptidase_C19B, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
Score = 60.8 bits (148), Expect = 1e-12
Identities = 16/40 (40%), Positives = 28/40 (70%)
Query: 32 TTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTID 71
TT +FPDYL+ ++K+F + E+W KLDV +++P+ +
Sbjct: 209 TTGFKTFPDYLVINMKRFQLLENWVPKKLDVPIDVPEELG 248
|
Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome. Length = 311 |
| >gnl|CDD|239072 cd02257, Peptidase_C19, Peptidase C19 contains ubiquitinyl hydrolases | Back alignment and domain information |
|---|
| >gnl|CDD|215922 pfam00443, UCH, Ubiquitin carboxyl-terminal hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|239125 cd02660, Peptidase_C19D, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 91 | |||
| KOG0944|consensus | 763 | 99.86 | ||
| cd02668 | 324 | Peptidase_C19L A subfamily of Peptidase C19. Pepti | 99.72 | |
| cd02667 | 279 | Peptidase_C19K A subfamily of Peptidase C19. Pepti | 99.7 | |
| cd02660 | 328 | Peptidase_C19D A subfamily of Peptidase C19. Pepti | 99.7 | |
| cd02663 | 300 | Peptidase_C19G A subfamily of Peptidase C19. Pepti | 99.68 | |
| KOG1865|consensus | 545 | 99.66 | ||
| cd02664 | 327 | Peptidase_C19H A subfamily of Peptidase C19. Pepti | 99.66 | |
| COG5560 | 823 | UBP12 Ubiquitin C-terminal hydrolase [Posttranslat | 99.65 | |
| cd02671 | 332 | Peptidase_C19O A subfamily of Peptidase C19. Pepti | 99.63 | |
| cd02659 | 334 | peptidase_C19C A subfamily of Peptidase C19. Pepti | 99.59 | |
| cd02669 | 440 | Peptidase_C19M A subfamily of Peptidase C19. Pepti | 99.57 | |
| cd02657 | 305 | Peptidase_C19A A subfamily of Peptidase C19. Pepti | 99.56 | |
| cd02658 | 311 | Peptidase_C19B A subfamily of Peptidase C19. Pepti | 99.54 | |
| KOG1866|consensus | 944 | 99.52 | ||
| KOG1870|consensus | 842 | 99.51 | ||
| cd02674 | 230 | Peptidase_C19R A subfamily of peptidase C19. Pepti | 99.51 | |
| cd02661 | 304 | Peptidase_C19E A subfamily of Peptidase C19. Pepti | 99.5 | |
| cd02662 | 240 | Peptidase_C19F A subfamily of Peptidase C19. Pepti | 99.39 | |
| KOG4598|consensus | 1203 | 99.37 | ||
| cd02672 | 268 | Peptidase_C19P A subfamily of Peptidase C19. Pepti | 99.35 | |
| cd02670 | 241 | Peptidase_C19N A subfamily of Peptidase C19. Pepti | 99.34 | |
| COG5207 | 749 | UBP14 Isopeptidase T [Posttranslational modificati | 99.25 | |
| cd02257 | 255 | Peptidase_C19 Peptidase C19 contains ubiquitinyl h | 99.25 | |
| COG5533 | 415 | UBP5 Ubiquitin C-terminal hydrolase [Posttranslati | 99.2 | |
| cd02665 | 228 | Peptidase_C19I A subfamily of Peptidase C19. Pepti | 99.06 | |
| KOG1868|consensus | 653 | 98.97 | ||
| KOG1867|consensus | 492 | 98.93 | ||
| PF00443 | 269 | UCH: Ubiquitin carboxyl-terminal hydrolase; InterP | 98.92 | |
| cd02673 | 245 | Peptidase_C19Q A subfamily of Peptidase C19. Pepti | 98.9 | |
| PF13423 | 295 | UCH_1: Ubiquitin carboxyl-terminal hydrolase | 98.69 | |
| KOG1864|consensus | 587 | 98.62 | ||
| KOG1873|consensus | 877 | 98.6 | ||
| COG5077 | 1089 | Ubiquitin carboxyl-terminal hydrolase [Posttransla | 98.48 | |
| KOG1863|consensus | 1093 | 98.41 | ||
| KOG2026|consensus | 442 | 97.52 | ||
| KOG1871|consensus | 420 | 97.11 | ||
| KOG1872|consensus | 473 | 96.36 | ||
| COG3478 | 68 | Predicted nucleic-acid-binding protein containing | 92.34 | |
| PF09855 | 64 | DUF2082: Nucleic-acid-binding protein containing Z | 88.21 | |
| cd02666 | 343 | Peptidase_C19J A subfamily of Peptidase C19. Pepti | 83.84 | |
| PF15499 | 275 | Peptidase_C98: Ubiquitin-specific peptidase-like, | 80.5 |
| >KOG0944|consensus | Back alignment and domain information |
|---|
Probab=99.86 E-value=1.6e-22 Score=161.65 Aligned_cols=86 Identities=38% Similarity=0.674 Sum_probs=82.0
Q ss_pred CCCCchhhhh-------cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecCCCCCCCCCCC
Q psy3162 5 QPTKSFLGLY-------CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRG 77 (91)
Q Consensus 5 ~~~~sl~~cl-------~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P~~LDls~~~~ 77 (91)
|..|++..|+ .++|.|.+||+|..|+|+++|++||+|||||++||.+ .+|.++|++++|++|++|||+.|++
T Consensus 470 ~~~v~~~~cleaff~pq~~df~s~ac~~K~~a~kt~~~ksfP~yLiiqv~rf~~-~dw~pkKld~~iempe~ldls~~rs 548 (763)
T KOG0944|consen 470 REKVPISACLEAFFEPQVDDFWSTACGEKKGATKTTRFKSFPDYLIIQVGRFTL-QDWVPKKLDVSIEMPEELDLSSYRS 548 (763)
T ss_pred cccCCHHHHHHHhcCCcchhhhhHhhcCccccccccccccCCceEEEEeeEEEe-cCceeeeeccceecchhhchhhhhh
Confidence 5678899999 4699999999999999999999999999999999999 8999999999999999999999999
Q ss_pred CCCCCCCccCCCCC
Q psy3162 78 SGPQPGEEMLPEVA 91 (91)
Q Consensus 78 ~g~q~ge~~lpe~~ 91 (91)
.|+||||++||+++
T Consensus 549 ~g~~p~ee~lpde~ 562 (763)
T KOG0944|consen 549 KGLQPGEEALPDEA 562 (763)
T ss_pred cCCCCcccccCCcC
Confidence 99999999999975
|
|
| >cd02668 Peptidase_C19L A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02667 Peptidase_C19K A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02660 Peptidase_C19D A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02663 Peptidase_C19G A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >KOG1865|consensus | Back alignment and domain information |
|---|
| >cd02664 Peptidase_C19H A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >COG5560 UBP12 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02671 Peptidase_C19O A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02659 peptidase_C19C A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02669 Peptidase_C19M A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02657 Peptidase_C19A A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02658 Peptidase_C19B A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >KOG1866|consensus | Back alignment and domain information |
|---|
| >KOG1870|consensus | Back alignment and domain information |
|---|
| >cd02674 Peptidase_C19R A subfamily of peptidase C19 | Back alignment and domain information |
|---|
| >cd02661 Peptidase_C19E A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02662 Peptidase_C19F A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >KOG4598|consensus | Back alignment and domain information |
|---|
| >cd02672 Peptidase_C19P A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02670 Peptidase_C19N A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02257 Peptidase_C19 Peptidase C19 contains ubiquitinyl hydrolases | Back alignment and domain information |
|---|
| >COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02665 Peptidase_C19I A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >KOG1868|consensus | Back alignment and domain information |
|---|
| >KOG1867|consensus | Back alignment and domain information |
|---|
| >PF00443 UCH: Ubiquitin carboxyl-terminal hydrolase; InterPro: IPR001394 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd02673 Peptidase_C19Q A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >PF13423 UCH_1: Ubiquitin carboxyl-terminal hydrolase | Back alignment and domain information |
|---|
| >KOG1864|consensus | Back alignment and domain information |
|---|
| >KOG1873|consensus | Back alignment and domain information |
|---|
| >COG5077 Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1863|consensus | Back alignment and domain information |
|---|
| >KOG2026|consensus | Back alignment and domain information |
|---|
| >KOG1871|consensus | Back alignment and domain information |
|---|
| >KOG1872|consensus | Back alignment and domain information |
|---|
| >COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF09855 DUF2082: Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082); InterPro: IPR018652 This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins | Back alignment and domain information |
|---|
| >cd02666 Peptidase_C19J A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >PF15499 Peptidase_C98: Ubiquitin-specific peptidase-like, SUMO isopeptidase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 91 | ||||
| 3ihp_A | 854 | Covalent Ubiquitin-Usp5 Complex Length = 854 | 6e-17 |
| >pdb|3IHP|A Chain A, Covalent Ubiquitin-Usp5 Complex Length = 854 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 91 | |||
| 3ihp_A | 854 | Ubiquitin carboxyl-terminal hydrolase 5; hydrolase | 4e-17 | |
| 3mhs_A | 476 | Ubiquitin carboxyl-terminal hydrolase 8; multi-pro | 4e-07 | |
| 2ayn_A | 404 | Ubiquitin carboxyl-terminal hydrolase 14; deubiqui | 1e-05 | |
| 1nb8_A | 353 | Ubiquitin carboxyl-terminal hydrolase 7; UBP, deub | 1e-05 | |
| 2f1z_A | 522 | Ubiquitin carboxyl-terminal hydrolase 7; hausp, US | 4e-05 |
| >3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854 | Back alignment and structure |
|---|
Score = 73.4 bits (179), Expect = 4e-17
Identities = 36/63 (57%), Positives = 48/63 (76%)
Query: 29 TLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRGSGPQPGEEMLP 88
++TTR ASFPDYL+ +KKFT DW KLDV +EMP+ +D++ LRG+G QPGEE LP
Sbjct: 575 AVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDISQLRGTGLQPGEEELP 634
Query: 89 EVA 91
++A
Sbjct: 635 DIA 637
|
| >3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 3m99_A Length = 476 | Back alignment and structure |
|---|
| >2ayn_A Ubiquitin carboxyl-terminal hydrolase 14; deubiquitinating enzymes, DUB, USP14, proteasome, enzyme mechanism; 3.20A {Homo sapiens} SCOP: d.3.1.9 PDB: 2ayo_A Length = 404 | Back alignment and structure |
|---|
| >1nb8_A Ubiquitin carboxyl-terminal hydrolase 7; UBP, deubiquitination, hausp, P53 binding; 2.30A {Homo sapiens} SCOP: d.3.1.9 PDB: 1nbf_A Length = 353 | Back alignment and structure |
|---|
| >2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Length = 522 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 91 | |||
| 3ihp_A | 854 | Ubiquitin carboxyl-terminal hydrolase 5; hydrolase | 99.86 | |
| 2y6e_A | 367 | Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; | 99.74 | |
| 2gfo_A | 396 | Ubiquitin carboxyl-terminal hydrolase 8; protease, | 99.68 | |
| 3i3t_A | 355 | Ubiquitin carboxyl-terminal hydrolase 21; hydrolas | 99.68 | |
| 3mhs_A | 476 | Ubiquitin carboxyl-terminal hydrolase 8; multi-pro | 99.67 | |
| 3nhe_A | 348 | Ubiquitin carboxyl-terminal hydrolase 2; cysteine | 99.66 | |
| 1vjv_A | 415 | Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, | 99.62 | |
| 2ayn_A | 404 | Ubiquitin carboxyl-terminal hydrolase 14; deubiqui | 99.6 | |
| 1nb8_A | 353 | Ubiquitin carboxyl-terminal hydrolase 7; UBP, deub | 99.57 | |
| 2f1z_A | 522 | Ubiquitin carboxyl-terminal hydrolase 7; hausp, US | 99.54 | |
| 2vhf_A | 374 | Ubiquitin carboxyl-terminal hydrolase CYLD; cytoki | 98.0 | |
| 2con_A | 79 | RUH-035 protein, NIN one binding protein; ribosome | 83.07 |
| >3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.86 E-value=1.3e-22 Score=165.43 Aligned_cols=86 Identities=44% Similarity=0.782 Sum_probs=81.0
Q ss_pred CCCCchhhhh--------cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecCCCCCCCCCC
Q psy3162 5 QPTKSFLGLY--------CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLR 76 (91)
Q Consensus 5 ~~~~sl~~cl--------~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P~~LDls~~~ 76 (91)
++.+||++|| +++|+|++|+.++.|+|++.|.+||+||+||||||.++.+|...|+++.|.||+.|||++|+
T Consensus 543 ~~~~sL~dcL~~f~~~E~Le~y~C~~C~~k~~a~K~~~i~~lP~vLiihLkRF~~d~~~~~~Ki~~~V~FP~~LDl~~y~ 622 (854)
T 3ihp_A 543 RAQVPFSSCLEAYGAPEQVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDISQLR 622 (854)
T ss_dssp CEECCHHHHHHHHHSCEEEEEEEETTTTEEEEEEEEEEESSCCSEEEEEECCEEECGGGCEEECCEECCCCSEEECGGGB
T ss_pred cCCCCHHHHHHHhcCceEeeeeeccccCCcceeeEEEEeeeCCceEEEEeehheecCCCceEECCeEEecCCcEehHHhc
Confidence 4558999999 56799999999999999999999999999999999997679999999999999999999999
Q ss_pred CCCCCCCCccCCCC
Q psy3162 77 GSGPQPGEEMLPEV 90 (91)
Q Consensus 77 ~~g~q~ge~~lpe~ 90 (91)
+.|.|+||+++|+.
T Consensus 623 ~~~~q~~E~~lp~~ 636 (854)
T 3ihp_A 623 GTGLQPGEEELPDI 636 (854)
T ss_dssp CCCSCTTCCBCCCC
T ss_pred cCCCCCCceecccc
Confidence 99999999999984
|
| >2y6e_A Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2gfo_A Ubiquitin carboxyl-terminal hydrolase 8; protease, thiol protease, UBL conjugation pathway deubiquitinating enzyme, DUB, zinc ribbon; 2.00A {Homo sapiens} SCOP: d.3.1.9 PDB: 3n3k_A | Back alignment and structure |
|---|
| >3i3t_A Ubiquitin carboxyl-terminal hydrolase 21; hydrolase, structural genomics consortium, SGC, activator, alternative splicing, chromatin regulator, nucleus, polymorphism, protease; 2.59A {Homo sapiens} SCOP: d.3.1.0 PDB: 2y5b_A 3mtn_A | Back alignment and structure |
|---|
| >3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 4fjc_A 4fk5_A 4fip_A 3m99_A | Back alignment and structure |
|---|
| >3nhe_A Ubiquitin carboxyl-terminal hydrolase 2; cysteine protease, substrate ENZY complex, hydrolase-protein binding complex; HET: CME; 1.26A {Homo sapiens} SCOP: d.3.1.9 PDB: 2hd5_A 3v6c_A 3v6e_A 2ibi_A | Back alignment and structure |
|---|
| >1vjv_A Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE; 1.74A {Saccharomyces cerevisiae} SCOP: d.3.1.9 | Back alignment and structure |
|---|
| >2ayn_A Ubiquitin carboxyl-terminal hydrolase 14; deubiquitinating enzymes, DUB, USP14, proteasome, enzyme mechanism; 3.20A {Homo sapiens} SCOP: d.3.1.9 PDB: 2ayo_A | Back alignment and structure |
|---|
| >1nb8_A Ubiquitin carboxyl-terminal hydrolase 7; UBP, deubiquitination, hausp, P53 binding; 2.30A {Homo sapiens} SCOP: d.3.1.9 PDB: 1nbf_A | Back alignment and structure |
|---|
| >2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2vhf_A Ubiquitin carboxyl-terminal hydrolase CYLD; cytokine signalling, linkage specificity, deubiquitinating enzyme, Lys63- linked, anti-oncogene; 2.8A {Homo sapiens} | Back alignment and structure |
|---|
| >2con_A RUH-035 protein, NIN one binding protein; ribosome, RNA binding protein, unknown function, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.15.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 91 | |||
| d1nbfa_ | 347 | Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAU | 99.32 | |
| d2ayna1 | 383 | Ubiquitin carboxyl-terminal hydrolase 14 {Human (H | 99.26 | |
| d2hd5a1 | 336 | Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Hum | 98.69 | |
| d2gfoa1 | 348 | Ubiquitin carboxyl-terminal hydrolase 8 {Human (Ho | 98.56 | |
| d1vjva_ | 397 | Ubiquitin carboxyl-terminal hydrolase 6 {Baker's y | 98.36 |
| >d1nbfa_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Ubiquitin carboxyl-terminal hydrolase, UCH domain: Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.32 E-value=7.5e-13 Score=94.44 Aligned_cols=62 Identities=13% Similarity=0.188 Sum_probs=53.4
Q ss_pred cccCCCCCcceeEEEeecccCCCeeEEEeeceEECC-CCeeeecceEEecCCCCCCCCCCCCC
Q psy3162 18 VLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKE-DWTLAKLDVEVEMPDTIDLTPLRGSG 79 (91)
Q Consensus 18 ~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~-~~~~~Kl~~~V~~P~~LDls~~~~~g 79 (91)
..|..|+....|.|+..|.++|++|+|||+||.++. .+...|++..|.||+.|||++|....
T Consensus 171 ~~~~~~~~~~~~~k~~~i~~lP~vL~i~l~Rf~~~~~~~~~~K~~~~v~fp~~Ldl~~~~~~~ 233 (347)
T d1nbfa_ 171 KYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKT 233 (347)
T ss_dssp CEECSTTCEECEEEEEEEEECCSEEEEEEECEEEETTTTEEEECCCCCBCCSEEECGGGBSSC
T ss_pred ccccccCcceeccEEEEEEecCChheEeeeeeeeccccCcccccCceEeeeeeeccccccccc
Confidence 445556677889999999999999999999999864 47788999999999999999998554
|
| >d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hd5a1 d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfoa1 d.3.1.9 (A:762-1109) Ubiquitin carboxyl-terminal hydrolase 8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjva_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|