Psyllid ID: psy3162


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MPKPQPTKSFLGLYCGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRGSGPQPGEEMLPEVA
cccccccccccccccccEEccccccEEEEEEEEEccccccEEEEEEEEEEEccccEEEEEcEEEEcccEEEcccccccccccccccccccc
ccccccHHHHHHHHHHHHHcHHHcccccEEEEEEccccccEEEEEEEEEEEcccccccEEcEEEEccccccHHHHcccccccccccccccc
mpkpqptksflglYCGKVLTYALDFVLSTLrttrlasfpDYLMFHLKKFTMKEDWTLAKLdvevempdtidltplrgsgpqpgeemlpeva
mpkpqptksFLGLYCGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTidltplrgsgpqpgeemlpeva
MPKPQPTKSFLGLYCGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRGSGPQPGEEMLPEVA
*********FLGLYCGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTI*********************
******T*SFLGLYCGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTP*************P***
MPKPQPTKSFLGLYCGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRGSGP***********
MPKPQPTKSFLGLYCGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRG**************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPKPQPTKSFLGLYCGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRGSGPQPGEEMLPEVA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query91 2.2.26 [Sep-21-2011]
P56399 858 Ubiquitin carboxyl-termin yes N/A 0.769 0.081 0.542 7e-16
P45974 858 Ubiquitin carboxyl-termin yes N/A 0.769 0.081 0.542 7e-16
Q5R407 858 Ubiquitin carboxyl-termin yes N/A 0.769 0.081 0.542 8e-16
Q8L6Y1 797 Ubiquitin carboxyl-termin yes N/A 0.769 0.087 0.485 6e-15
E1BMF7 863 Ubiquitin carboxyl-termin no N/A 0.791 0.083 0.472 1e-13
Q5BKP2 858 Ubiquitin carboxyl-termin no N/A 0.769 0.081 0.471 1e-13
Q92995 863 Ubiquitin carboxyl-termin no N/A 0.769 0.081 0.471 2e-13
E1BY77 862 Ubiquitin carboxyl-termin no N/A 0.725 0.076 0.5 4e-12
F1QFS9 860 Ubiquitin carboxyl-termin no N/A 0.780 0.082 0.450 1e-11
F6V6I0 846 Ubiquitin carboxyl-termin no N/A 0.725 0.078 0.469 3e-11
>sp|P56399|UBP5_MOUSE Ubiquitin carboxyl-terminal hydrolase 5 OS=Mus musculus GN=Usp5 PE=1 SV=1 Back     alignment and function desciption
 Score = 82.4 bits (202), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 50/70 (71%)

Query: 22  ALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRGSGPQ 81
           AL      ++TTR ASFPDYL+  +KKFT   DW   KLDV +EMP+ +D++ LRG+G Q
Sbjct: 549 ALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDISQLRGTGLQ 608

Query: 82  PGEEMLPEVA 91
           PGEE LP++A
Sbjct: 609 PGEEELPDIA 618




Cleaves linear and branched multiubiquitin polymers with a marked preference for branched polymers. Involved in unanchored 'Lys-48'-linked polyubiquitin disassembly. Binds linear and 'Lys-63'-linked polyubiquitin with a lower affinity.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 4EC: .EC: 1EC: 9EC: .EC: 1EC: 2
>sp|P45974|UBP5_HUMAN Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens GN=USP5 PE=1 SV=2 Back     alignment and function description
>sp|Q5R407|UBP5_PONAB Ubiquitin carboxyl-terminal hydrolase 5 OS=Pongo abelii GN=UBP5 PE=2 SV=1 Back     alignment and function description
>sp|Q8L6Y1|UBP14_ARATH Ubiquitin carboxyl-terminal hydrolase 14 OS=Arabidopsis thaliana GN=UBP14 PE=1 SV=1 Back     alignment and function description
>sp|E1BMF7|UBP13_BOVIN Ubiquitin carboxyl-terminal hydrolase 13 OS=Bos taurus GN=USP13 PE=3 SV=2 Back     alignment and function description
>sp|Q5BKP2|UBP13_MOUSE Ubiquitin carboxyl-terminal hydrolase 13 OS=Mus musculus GN=Usp13 PE=2 SV=1 Back     alignment and function description
>sp|Q92995|UBP13_HUMAN Ubiquitin carboxyl-terminal hydrolase 13 OS=Homo sapiens GN=USP13 PE=1 SV=2 Back     alignment and function description
>sp|E1BY77|UBP13_CHICK Ubiquitin carboxyl-terminal hydrolase 13 OS=Gallus gallus GN=USP13 PE=3 SV=1 Back     alignment and function description
>sp|F1QFS9|UBP13_DANRE Ubiquitin carboxyl-terminal hydrolase 13 OS=Danio rerio GN=usp13 PE=2 SV=1 Back     alignment and function description
>sp|F6V6I0|UBP13_XENTR Ubiquitin carboxyl-terminal hydrolase 13 OS=Xenopus tropicalis GN=usp13 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
322801464 818 hypothetical protein SINV_08392 [Solenop 0.670 0.074 0.737 5e-19
307174012 799 Ubiquitin carboxyl-terminal hydrolase 5 0.648 0.073 0.762 6e-19
332019367 803 Ubiquitin carboxyl-terminal hydrolase 5 0.670 0.075 0.737 2e-18
340714339 810 PREDICTED: ubiquitin carboxyl-terminal h 0.747 0.083 0.661 5e-18
340714337 802 PREDICTED: ubiquitin carboxyl-terminal h 0.747 0.084 0.661 6e-18
350417343 802 PREDICTED: ubiquitin carboxyl-terminal h 0.747 0.084 0.661 6e-18
380025673 805 PREDICTED: LOW QUALITY PROTEIN: ubiquiti 0.747 0.084 0.647 1e-17
156543203 799 PREDICTED: ubiquitin carboxyl-terminal h 0.747 0.085 0.676 1e-17
307192538 806 Ubiquitin carboxyl-terminal hydrolase 5 0.747 0.084 0.647 2e-17
328788537 802 PREDICTED: ubiquitin carboxyl-terminal h 0.747 0.084 0.647 4e-17
>gi|322801464|gb|EFZ22125.1| hypothetical protein SINV_08392 [Solenopsis invicta] Back     alignment and taxonomy information
 Score = 98.6 bits (244), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 45/61 (73%), Positives = 54/61 (88%)

Query: 31  RTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRGSGPQPGEEMLPEV 90
           +TTRLASFPDYL+ HLKKFT+KEDWT  KLDV +EMPDT+DL+ LRG+G QPGEE+LP+ 
Sbjct: 563 KTTRLASFPDYLLIHLKKFTVKEDWTPIKLDVAIEMPDTVDLSFLRGNGLQPGEELLPDG 622

Query: 91  A 91
           A
Sbjct: 623 A 623




Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307174012|gb|EFN64722.1| Ubiquitin carboxyl-terminal hydrolase 5 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332019367|gb|EGI59868.1| Ubiquitin carboxyl-terminal hydrolase 5 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340714339|ref|XP_003395687.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 5-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|340714337|ref|XP_003395686.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 5-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350417343|ref|XP_003491376.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 5-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380025673|ref|XP_003696593.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 5-like [Apis florea] Back     alignment and taxonomy information
>gi|156543203|ref|XP_001606298.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 5-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307192538|gb|EFN75726.1| Ubiquitin carboxyl-terminal hydrolase 5 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328788537|ref|XP_624702.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase 5-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
UNIPROTKB|F1N3P2 858 USP5 "Ubiquitin carboxyl-termi 0.681 0.072 0.580 4e-15
UNIPROTKB|P45974 858 USP5 "Ubiquitin carboxyl-termi 0.681 0.072 0.580 4e-15
MGI|MGI:1347343 858 Usp5 "ubiquitin specific pepti 0.681 0.072 0.580 4e-15
RGD|1308438 858 Usp5 "ubiquitin specific pepti 0.681 0.072 0.580 4e-15
UNIPROTKB|F1SLU6 859 USP5 "Ubiquitin carboxyl-termi 0.681 0.072 0.580 4e-15
UNIPROTKB|F1P9P5 868 USP5 "Ubiquitin carboxyl-termi 0.681 0.071 0.580 4e-15
TAIR|locus:2083440 797 UBP14 "ubiquitin-specific prot 0.747 0.085 0.5 2e-14
UNIPROTKB|E1C8W4 833 USP5 "Ubiquitin carboxyl-termi 0.681 0.074 0.548 5.7e-14
UNIPROTKB|H7C5J3299 USP13 "Ubiquitin carboxyl-term 0.769 0.234 0.471 1.3e-13
UNIPROTKB|F1SGC5 436 USP13 "Uncharacterized protein 0.769 0.160 0.471 4.6e-13
UNIPROTKB|F1N3P2 USP5 "Ubiquitin carboxyl-terminal hydrolase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 203 (76.5 bits), Expect = 4.0e-15, P = 4.0e-15
 Identities = 36/62 (58%), Positives = 48/62 (77%)

Query:    30 LRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRGSGPQPGEEMLPE 89
             ++TTR ASFPDYL+  +KKFT   DW   KLDV +EMP+ +D++ LRG+G QPGEE LP+
Sbjct:   557 VKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDISQLRGTGLQPGEEELPD 616

Query:    90 VA 91
             +A
Sbjct:   617 IA 618




GO:0071108 "protein K48-linked deubiquitination" evidence=IEA
GO:0032436 "positive regulation of proteasomal ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0008234 "cysteine-type peptidase activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0008242 "omega peptidase activity" evidence=IEA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0004221 "ubiquitin thiolesterase activity" evidence=IEA
UNIPROTKB|P45974 USP5 "Ubiquitin carboxyl-terminal hydrolase 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1347343 Usp5 "ubiquitin specific peptidase 5 (isopeptidase T)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308438 Usp5 "ubiquitin specific peptidase 5 (isopeptidase T)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SLU6 USP5 "Ubiquitin carboxyl-terminal hydrolase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P9P5 USP5 "Ubiquitin carboxyl-terminal hydrolase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
TAIR|locus:2083440 UBP14 "ubiquitin-specific protease 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8W4 USP5 "Ubiquitin carboxyl-terminal hydrolase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H7C5J3 USP13 "Ubiquitin carboxyl-terminal hydrolase 13" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SGC5 USP13 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P56399UBP5_MOUSE3, ., 4, ., 1, 9, ., 1, 20.54280.76920.0815yesN/A
P45974UBP5_HUMAN3, ., 4, ., 1, 9, ., 1, 20.54280.76920.0815yesN/A
Q5R407UBP5_PONAB3, ., 4, ., 1, 9, ., 1, 20.54280.76920.0815yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
cd02658311 cd02658, Peptidase_C19B, A subfamily of Peptidase 1e-12
cd02257255 cd02257, Peptidase_C19, Peptidase C19 contains ubi 3e-10
pfam00443313 pfam00443, UCH, Ubiquitin carboxyl-terminal hydrol 4e-10
cd02660328 cd02660, Peptidase_C19D, A subfamily of Peptidase 0.002
>gnl|CDD|239123 cd02658, Peptidase_C19B, A subfamily of Peptidase C19 Back     alignment and domain information
 Score = 60.8 bits (148), Expect = 1e-12
 Identities = 16/40 (40%), Positives = 28/40 (70%)

Query: 32  TTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTID 71
           TT   +FPDYL+ ++K+F + E+W   KLDV +++P+ + 
Sbjct: 209 TTGFKTFPDYLVINMKRFQLLENWVPKKLDVPIDVPEELG 248


Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome. Length = 311

>gnl|CDD|239072 cd02257, Peptidase_C19, Peptidase C19 contains ubiquitinyl hydrolases Back     alignment and domain information
>gnl|CDD|215922 pfam00443, UCH, Ubiquitin carboxyl-terminal hydrolase Back     alignment and domain information
>gnl|CDD|239125 cd02660, Peptidase_C19D, A subfamily of Peptidase C19 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 91
KOG0944|consensus 763 99.86
cd02668324 Peptidase_C19L A subfamily of Peptidase C19. Pepti 99.72
cd02667279 Peptidase_C19K A subfamily of Peptidase C19. Pepti 99.7
cd02660328 Peptidase_C19D A subfamily of Peptidase C19. Pepti 99.7
cd02663300 Peptidase_C19G A subfamily of Peptidase C19. Pepti 99.68
KOG1865|consensus 545 99.66
cd02664327 Peptidase_C19H A subfamily of Peptidase C19. Pepti 99.66
COG5560823 UBP12 Ubiquitin C-terminal hydrolase [Posttranslat 99.65
cd02671332 Peptidase_C19O A subfamily of Peptidase C19. Pepti 99.63
cd02659334 peptidase_C19C A subfamily of Peptidase C19. Pepti 99.59
cd02669440 Peptidase_C19M A subfamily of Peptidase C19. Pepti 99.57
cd02657305 Peptidase_C19A A subfamily of Peptidase C19. Pepti 99.56
cd02658311 Peptidase_C19B A subfamily of Peptidase C19. Pepti 99.54
KOG1866|consensus 944 99.52
KOG1870|consensus842 99.51
cd02674230 Peptidase_C19R A subfamily of peptidase C19. Pepti 99.51
cd02661304 Peptidase_C19E A subfamily of Peptidase C19. Pepti 99.5
cd02662240 Peptidase_C19F A subfamily of Peptidase C19. Pepti 99.39
KOG4598|consensus 1203 99.37
cd02672268 Peptidase_C19P A subfamily of Peptidase C19. Pepti 99.35
cd02670241 Peptidase_C19N A subfamily of Peptidase C19. Pepti 99.34
COG5207 749 UBP14 Isopeptidase T [Posttranslational modificati 99.25
cd02257255 Peptidase_C19 Peptidase C19 contains ubiquitinyl h 99.25
COG5533415 UBP5 Ubiquitin C-terminal hydrolase [Posttranslati 99.2
cd02665228 Peptidase_C19I A subfamily of Peptidase C19. Pepti 99.06
KOG1868|consensus653 98.97
KOG1867|consensus492 98.93
PF00443269 UCH: Ubiquitin carboxyl-terminal hydrolase; InterP 98.92
cd02673245 Peptidase_C19Q A subfamily of Peptidase C19. Pepti 98.9
PF13423295 UCH_1: Ubiquitin carboxyl-terminal hydrolase 98.69
KOG1864|consensus587 98.62
KOG1873|consensus877 98.6
COG5077 1089 Ubiquitin carboxyl-terminal hydrolase [Posttransla 98.48
KOG1863|consensus 1093 98.41
KOG2026|consensus442 97.52
KOG1871|consensus420 97.11
KOG1872|consensus 473 96.36
COG347868 Predicted nucleic-acid-binding protein containing 92.34
PF0985564 DUF2082: Nucleic-acid-binding protein containing Z 88.21
cd02666343 Peptidase_C19J A subfamily of Peptidase C19. Pepti 83.84
PF15499275 Peptidase_C98: Ubiquitin-specific peptidase-like, 80.5
>KOG0944|consensus Back     alignment and domain information
Probab=99.86  E-value=1.6e-22  Score=161.65  Aligned_cols=86  Identities=38%  Similarity=0.674  Sum_probs=82.0

Q ss_pred             CCCCchhhhh-------cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecCCCCCCCCCCC
Q psy3162           5 QPTKSFLGLY-------CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRG   77 (91)
Q Consensus         5 ~~~~sl~~cl-------~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P~~LDls~~~~   77 (91)
                      |..|++..|+       .++|.|.+||+|..|+|+++|++||+|||||++||.+ .+|.++|++++|++|++|||+.|++
T Consensus       470 ~~~v~~~~cleaff~pq~~df~s~ac~~K~~a~kt~~~ksfP~yLiiqv~rf~~-~dw~pkKld~~iempe~ldls~~rs  548 (763)
T KOG0944|consen  470 REKVPISACLEAFFEPQVDDFWSTACGEKKGATKTTRFKSFPDYLIIQVGRFTL-QDWVPKKLDVSIEMPEELDLSSYRS  548 (763)
T ss_pred             cccCCHHHHHHHhcCCcchhhhhHhhcCccccccccccccCCceEEEEeeEEEe-cCceeeeeccceecchhhchhhhhh
Confidence            5678899999       4699999999999999999999999999999999999 8999999999999999999999999


Q ss_pred             CCCCCCCccCCCCC
Q psy3162          78 SGPQPGEEMLPEVA   91 (91)
Q Consensus        78 ~g~q~ge~~lpe~~   91 (91)
                      .|+||||++||+++
T Consensus       549 ~g~~p~ee~lpde~  562 (763)
T KOG0944|consen  549 KGLQPGEEALPDEA  562 (763)
T ss_pred             cCCCCcccccCCcC
Confidence            99999999999975



>cd02668 Peptidase_C19L A subfamily of Peptidase C19 Back     alignment and domain information
>cd02667 Peptidase_C19K A subfamily of Peptidase C19 Back     alignment and domain information
>cd02660 Peptidase_C19D A subfamily of Peptidase C19 Back     alignment and domain information
>cd02663 Peptidase_C19G A subfamily of Peptidase C19 Back     alignment and domain information
>KOG1865|consensus Back     alignment and domain information
>cd02664 Peptidase_C19H A subfamily of Peptidase C19 Back     alignment and domain information
>COG5560 UBP12 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02671 Peptidase_C19O A subfamily of Peptidase C19 Back     alignment and domain information
>cd02659 peptidase_C19C A subfamily of Peptidase C19 Back     alignment and domain information
>cd02669 Peptidase_C19M A subfamily of Peptidase C19 Back     alignment and domain information
>cd02657 Peptidase_C19A A subfamily of Peptidase C19 Back     alignment and domain information
>cd02658 Peptidase_C19B A subfamily of Peptidase C19 Back     alignment and domain information
>KOG1866|consensus Back     alignment and domain information
>KOG1870|consensus Back     alignment and domain information
>cd02674 Peptidase_C19R A subfamily of peptidase C19 Back     alignment and domain information
>cd02661 Peptidase_C19E A subfamily of Peptidase C19 Back     alignment and domain information
>cd02662 Peptidase_C19F A subfamily of Peptidase C19 Back     alignment and domain information
>KOG4598|consensus Back     alignment and domain information
>cd02672 Peptidase_C19P A subfamily of Peptidase C19 Back     alignment and domain information
>cd02670 Peptidase_C19N A subfamily of Peptidase C19 Back     alignment and domain information
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02257 Peptidase_C19 Peptidase C19 contains ubiquitinyl hydrolases Back     alignment and domain information
>COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02665 Peptidase_C19I A subfamily of Peptidase C19 Back     alignment and domain information
>KOG1868|consensus Back     alignment and domain information
>KOG1867|consensus Back     alignment and domain information
>PF00443 UCH: Ubiquitin carboxyl-terminal hydrolase; InterPro: IPR001394 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd02673 Peptidase_C19Q A subfamily of Peptidase C19 Back     alignment and domain information
>PF13423 UCH_1: Ubiquitin carboxyl-terminal hydrolase Back     alignment and domain information
>KOG1864|consensus Back     alignment and domain information
>KOG1873|consensus Back     alignment and domain information
>COG5077 Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1863|consensus Back     alignment and domain information
>KOG2026|consensus Back     alignment and domain information
>KOG1871|consensus Back     alignment and domain information
>KOG1872|consensus Back     alignment and domain information
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only] Back     alignment and domain information
>PF09855 DUF2082: Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082); InterPro: IPR018652 This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins Back     alignment and domain information
>cd02666 Peptidase_C19J A subfamily of Peptidase C19 Back     alignment and domain information
>PF15499 Peptidase_C98: Ubiquitin-specific peptidase-like, SUMO isopeptidase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
3ihp_A 854 Covalent Ubiquitin-Usp5 Complex Length = 854 6e-17
>pdb|3IHP|A Chain A, Covalent Ubiquitin-Usp5 Complex Length = 854 Back     alignment and structure

Iteration: 1

Score = 82.4 bits (202), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 38/70 (54%), Positives = 50/70 (71%) Query: 22 ALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRGSGPQ 81 AL ++TTR ASFPDYL+ +KKFT DW KLDV +EMP+ +D++ LRG+G Q Sbjct: 568 ALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDISQLRGTGLQ 627 Query: 82 PGEEMLPEVA 91 PGEE LP++A Sbjct: 628 PGEEELPDIA 637

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
3ihp_A 854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 4e-17
3mhs_A476 Ubiquitin carboxyl-terminal hydrolase 8; multi-pro 4e-07
2ayn_A 404 Ubiquitin carboxyl-terminal hydrolase 14; deubiqui 1e-05
1nb8_A 353 Ubiquitin carboxyl-terminal hydrolase 7; UBP, deub 1e-05
2f1z_A 522 Ubiquitin carboxyl-terminal hydrolase 7; hausp, US 4e-05
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854 Back     alignment and structure
 Score = 73.4 bits (179), Expect = 4e-17
 Identities = 36/63 (57%), Positives = 48/63 (76%)

Query: 29  TLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRGSGPQPGEEMLP 88
            ++TTR ASFPDYL+  +KKFT   DW   KLDV +EMP+ +D++ LRG+G QPGEE LP
Sbjct: 575 AVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDISQLRGTGLQPGEEELP 634

Query: 89  EVA 91
           ++A
Sbjct: 635 DIA 637


>3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 3m99_A Length = 476 Back     alignment and structure
>2ayn_A Ubiquitin carboxyl-terminal hydrolase 14; deubiquitinating enzymes, DUB, USP14, proteasome, enzyme mechanism; 3.20A {Homo sapiens} SCOP: d.3.1.9 PDB: 2ayo_A Length = 404 Back     alignment and structure
>1nb8_A Ubiquitin carboxyl-terminal hydrolase 7; UBP, deubiquitination, hausp, P53 binding; 2.30A {Homo sapiens} SCOP: d.3.1.9 PDB: 1nbf_A Length = 353 Back     alignment and structure
>2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Length = 522 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
3ihp_A 854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 99.86
2y6e_A367 Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 99.74
2gfo_A396 Ubiquitin carboxyl-terminal hydrolase 8; protease, 99.68
3i3t_A355 Ubiquitin carboxyl-terminal hydrolase 21; hydrolas 99.68
3mhs_A476 Ubiquitin carboxyl-terminal hydrolase 8; multi-pro 99.67
3nhe_A348 Ubiquitin carboxyl-terminal hydrolase 2; cysteine 99.66
1vjv_A 415 Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, 99.62
2ayn_A 404 Ubiquitin carboxyl-terminal hydrolase 14; deubiqui 99.6
1nb8_A 353 Ubiquitin carboxyl-terminal hydrolase 7; UBP, deub 99.57
2f1z_A 522 Ubiquitin carboxyl-terminal hydrolase 7; hausp, US 99.54
2vhf_A 374 Ubiquitin carboxyl-terminal hydrolase CYLD; cytoki 98.0
2con_A79 RUH-035 protein, NIN one binding protein; ribosome 83.07
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
Probab=99.86  E-value=1.3e-22  Score=165.43  Aligned_cols=86  Identities=44%  Similarity=0.782  Sum_probs=81.0

Q ss_pred             CCCCchhhhh--------cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecCCCCCCCCCC
Q psy3162           5 QPTKSFLGLY--------CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLR   76 (91)
Q Consensus         5 ~~~~sl~~cl--------~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P~~LDls~~~   76 (91)
                      ++.+||++||        +++|+|++|+.++.|+|++.|.+||+||+||||||.++.+|...|+++.|.||+.|||++|+
T Consensus       543 ~~~~sL~dcL~~f~~~E~Le~y~C~~C~~k~~a~K~~~i~~lP~vLiihLkRF~~d~~~~~~Ki~~~V~FP~~LDl~~y~  622 (854)
T 3ihp_A          543 RAQVPFSSCLEAYGAPEQVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDISQLR  622 (854)
T ss_dssp             CEECCHHHHHHHHHSCEEEEEEEETTTTEEEEEEEEEEESSCCSEEEEEECCEEECGGGCEEECCEECCCCSEEECGGGB
T ss_pred             cCCCCHHHHHHHhcCceEeeeeeccccCCcceeeEEEEeeeCCceEEEEeehheecCCCceEECCeEEecCCcEehHHhc
Confidence            4558999999        56799999999999999999999999999999999997679999999999999999999999


Q ss_pred             CCCCCCCCccCCCC
Q psy3162          77 GSGPQPGEEMLPEV   90 (91)
Q Consensus        77 ~~g~q~ge~~lpe~   90 (91)
                      +.|.|+||+++|+.
T Consensus       623 ~~~~q~~E~~lp~~  636 (854)
T 3ihp_A          623 GTGLQPGEEELPDI  636 (854)
T ss_dssp             CCCSCTTCCBCCCC
T ss_pred             cCCCCCCceecccc
Confidence            99999999999984



>2y6e_A Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 2.40A {Homo sapiens} Back     alignment and structure
>2gfo_A Ubiquitin carboxyl-terminal hydrolase 8; protease, thiol protease, UBL conjugation pathway deubiquitinating enzyme, DUB, zinc ribbon; 2.00A {Homo sapiens} SCOP: d.3.1.9 PDB: 3n3k_A Back     alignment and structure
>3i3t_A Ubiquitin carboxyl-terminal hydrolase 21; hydrolase, structural genomics consortium, SGC, activator, alternative splicing, chromatin regulator, nucleus, polymorphism, protease; 2.59A {Homo sapiens} SCOP: d.3.1.0 PDB: 2y5b_A 3mtn_A Back     alignment and structure
>3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 4fjc_A 4fk5_A 4fip_A 3m99_A Back     alignment and structure
>3nhe_A Ubiquitin carboxyl-terminal hydrolase 2; cysteine protease, substrate ENZY complex, hydrolase-protein binding complex; HET: CME; 1.26A {Homo sapiens} SCOP: d.3.1.9 PDB: 2hd5_A 3v6c_A 3v6e_A 2ibi_A Back     alignment and structure
>1vjv_A Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE; 1.74A {Saccharomyces cerevisiae} SCOP: d.3.1.9 Back     alignment and structure
>2ayn_A Ubiquitin carboxyl-terminal hydrolase 14; deubiquitinating enzymes, DUB, USP14, proteasome, enzyme mechanism; 3.20A {Homo sapiens} SCOP: d.3.1.9 PDB: 2ayo_A Back     alignment and structure
>1nb8_A Ubiquitin carboxyl-terminal hydrolase 7; UBP, deubiquitination, hausp, P53 binding; 2.30A {Homo sapiens} SCOP: d.3.1.9 PDB: 1nbf_A Back     alignment and structure
>2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Back     alignment and structure
>2vhf_A Ubiquitin carboxyl-terminal hydrolase CYLD; cytokine signalling, linkage specificity, deubiquitinating enzyme, Lys63- linked, anti-oncogene; 2.8A {Homo sapiens} Back     alignment and structure
>2con_A RUH-035 protein, NIN one binding protein; ribosome, RNA binding protein, unknown function, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.15.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
d1nbfa_ 347 Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAU 99.32
d2ayna1 383 Ubiquitin carboxyl-terminal hydrolase 14 {Human (H 99.26
d2hd5a1336 Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Hum 98.69
d2gfoa1348 Ubiquitin carboxyl-terminal hydrolase 8 {Human (Ho 98.56
d1vjva_ 397 Ubiquitin carboxyl-terminal hydrolase 6 {Baker's y 98.36
>d1nbfa_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Ubiquitin carboxyl-terminal hydrolase, UCH
domain: Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.32  E-value=7.5e-13  Score=94.44  Aligned_cols=62  Identities=13%  Similarity=0.188  Sum_probs=53.4

Q ss_pred             cccCCCCCcceeEEEeecccCCCeeEEEeeceEECC-CCeeeecceEEecCCCCCCCCCCCCC
Q psy3162          18 VLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKE-DWTLAKLDVEVEMPDTIDLTPLRGSG   79 (91)
Q Consensus        18 ~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~-~~~~~Kl~~~V~~P~~LDls~~~~~g   79 (91)
                      ..|..|+....|.|+..|.++|++|+|||+||.++. .+...|++..|.||+.|||++|....
T Consensus       171 ~~~~~~~~~~~~~k~~~i~~lP~vL~i~l~Rf~~~~~~~~~~K~~~~v~fp~~Ldl~~~~~~~  233 (347)
T d1nbfa_         171 KYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKT  233 (347)
T ss_dssp             CEECSTTCEECEEEEEEEEECCSEEEEEEECEEEETTTTEEEECCCCCBCCSEEECGGGBSSC
T ss_pred             ccccccCcceeccEEEEEEecCChheEeeeeeeeccccCcccccCceEeeeeeeccccccccc
Confidence            445556677889999999999999999999999864 47788999999999999999998554



>d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hd5a1 d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfoa1 d.3.1.9 (A:762-1109) Ubiquitin carboxyl-terminal hydrolase 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjva_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure