Diaphorina citri psyllid: psy316


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
MKGFIELFAYDETMRIIIKAAADPVKKSDTVTEDSESEQHTGARPVRKSDMGMEDSVEHHVPMWTKVGFIGAGNMAQAVATSLIRTGLCIPAQIIASAPSERFKLHWPEPMDFALNDNHRIIKEAEYVFLAMKPQYLDSAIQGLVNDKVTLNSSRCIISMLVGVDLETLKKKLSVLVPNPNDAPTIIRVMPNTAMKYGKGITGMCHDVHLDKESEHLNMAIKIMEQGGIVEIIPESMMNSFGAIAGSGCAYLFLVMDAMADGAVKQGIPRDMALRIGAQLLKGSGQLVHKDLLRMDHAAQAHPAVIKDQICSPGGSTIAGIHALEKAGVRTPFSSAARRTK
ccccHHHHHHHHHHHHHHHHHccccccccccccccccHHccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHcccccccEEEECcccHHHHHHcccccccccccHHHHHHcccEEEEEEccccHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHcccccccccccccEEEEccccHHHHHcccEEECccccccccHHHHHHHHHHHHHcccEEEEccccccEEECccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHcc
*KGFIELFAYDETMRIIIKAAAD***********************************HHVPMWTKVGFIGAGNMAQAVATSLIRTGLCIPAQIIASAPSERFKLHWPEPMDFALNDNHRIIKEAEYVFLAMKPQYLDSAIQGLVNDKVTLNSSRCIISMLVGVDLETLKKKLSVLVPNPNDAPTIIRVMPNTAMKYGKGITGMCHDVHLDKESEHLNMAIKIMEQGGIVEIIPESMMNSFGAIAGSGCAYLFLVMDAMADGAVKQGIPRDMALRIGAQLLKGSGQLVHKDLLRMD**AQAHPAVIKDQICSPGGSTIAGIHALEKAGVRTPFSSAARRT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGFIELFAYDETMRIIIKAAADPVKKSDTVTEDSESEQHTGARPVRKSDMGMEDSVEHHVPMWTKVGFIGAGNMAQAVATSLIRTGLCIPAQIIASAPSERFKLHWPEPMDFALNDNHRIIKEAEYVFLAMKPQYLDSAIQGLVNDKVTLNSSRCIISMLVGVDLETLKKKLSVLVPNPNDAPTIIRVMPNTAMKYGKGITGMCHDVHLDKESEHLNMAIKIMEQGGIVEIIPESMMNSFGAIAGSGCAYLFLVMDAMADGAVKQGIPRDMALRIGAQLLKGSGQLVHKDLLRMDHAAQAHPAVIKDQICSPGGSTIAGIHALEKAGVRTPFSSAARRTK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pyrroline-5-carboxylate reductase 2 Housekeeping enzyme that catalyzes the last step in proline biosynthesis. In some cell types, such as erythrocytes, its primary function may be the generation of NADP(+). Can utilize both NAD and NADP. Has higher affinity for NADP, but higher catalytic efficiency with NADH.confidentQ5RAQ3
Pyrroline-5-carboxylate reductase 3 confidentQ5SPD7
Pyrroline-5-carboxylate reductase confidentP54904

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006561 [BP]proline biosynthetic processprobableGO:0044283, GO:0019752, GO:0044249, GO:0006807, GO:0044281, GO:0009064, GO:1901362, GO:1901360, GO:1901576, GO:0044710, GO:0044711, GO:0006560, GO:0006520, GO:0071704, GO:1901605, GO:1901607, GO:0018130, GO:0044238, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0046483, GO:0008652, GO:1901564, GO:0006082, GO:1901566, GO:0046394, GO:0016053, GO:0044237, GO:0009084
GO:0004735 [MF]pyrroline-5-carboxylate reductase activityprobableGO:0003824, GO:0003674, GO:0016646, GO:0016645, GO:0016491
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0050661 [MF]NADP bindingprobableGO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:1901363, GO:1901265
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IZZ, chain A
Confidence level:very confident
Coverage over the Query: 64-340
View the alignment between query and template
View the model in PyMOL