Diaphorina citri psyllid: psy3171


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
MSLFGLLSREDEGFIKEEEKPLPSHEFQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELSVRFLACPNKLNFFRDVMNIIDIIAIIPYFITLATVVAEEEDVLNLPKAPVSPQDKSTNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRECQFILHIIPSSILFRGIFVDRYYKETCIIVLRLSKAKVPIVIFRYLLCNSRYSQVTRVLRAATHYQVDLRGTPDQVDLTGTPDQVDLVGTPDQVYLTNT
ccccccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEEHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccEEEEEEccccEEEECccccccCCcccccccccccccccEEEEccc
*SLFGLLSREDE******E***PSHEFQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELSVRFLACPNKLNFFRDVMNIIDIIAIIPYFITLATVVAEEEDVLN*************NQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRECQFILHIIPSSILFRGIFVDRYYKETCIIVLRLSKAKVPIVIFRYLLCNSRYSQVTRVLRAATHYQVDLRGTPDQVDLTGTPDQVDLVGTPDQVYLT**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLFGLLSREDEGFIKEEEKPLPSHEFQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELSVRFLACPNKLNFFRDVMNIIDIIAIIPYFITLATVVAEEEDVLNLPKAPVSPQDKSTNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRECQFILHIIPSSILFRGIFVDRYYKETCIIVLRLSKAKVPIVIFRYLLCNSRYSQVTRVLRAATHYQVDLRGTPDQVDLTGTPDQVDLVGTPDQVYLTNT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Potassium voltage-gated channel protein Shaker Voltage-dependent potassium channel involved in regulation of sleep need or efficiency. Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.very confidentP08510
Potassium voltage-gated channel subfamily A member 1 Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.confidentP16388
Potassium voltage-gated channel subfamily A member 1 Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.confidentP10499

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048047 [BP]mating behavior, sex discriminationprobableGO:0044703, GO:0000003, GO:0007618, GO:0019098, GO:0007617, GO:0050896, GO:0007610, GO:0022414, GO:0008150, GO:0051705, GO:0051704
GO:0022843 [MF]voltage-gated cation channel activityprobableGO:0022891, GO:0022838, GO:0005261, GO:0005215, GO:0005216, GO:0008324, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0003674, GO:0022836, GO:0022892, GO:0022803, GO:0022839, GO:0005244
GO:0001508 [BP]regulation of action potentialprobableGO:0019725, GO:0042391, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0007629 [BP]flight behaviorprobableGO:0007626, GO:0032501, GO:0044707, GO:0030534, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0008344, GO:0044699
GO:0060025 [BP]regulation of synaptic activityprobableGO:0019226, GO:0035637, GO:0050803, GO:0050804, GO:0023052, GO:0023051, GO:0010646, GO:0050789, GO:0044699, GO:0044057, GO:0065007, GO:0065008, GO:0032501, GO:0050877, GO:0009987, GO:0050794, GO:0044763, GO:0051239, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:0031644, GO:0008150, GO:0051969
GO:0048675 [BP]axon extensionprobableGO:0032502, GO:0044707, GO:0048589, GO:0048588, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000902, GO:0000904, GO:0016049, GO:0040007, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0060560, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0022008, GO:0048858, GO:0048699, GO:0032990, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0008345 [BP]larval locomotory behaviorprobableGO:0007626, GO:0030537, GO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0044699
GO:0045187 [BP]regulation of circadian sleep/wake cycle, sleepprobableGO:0050896, GO:0007623, GO:0007622, GO:0044708, GO:0042745, GO:0048583, GO:0048512, GO:0050795, GO:0048511, GO:0042752, GO:0065007, GO:0022410, GO:0051239, GO:0008150, GO:0007610, GO:0050789, GO:0042749
GO:0007637 [BP]proboscis extension reflexprobableGO:0009991, GO:0060004, GO:0007635, GO:0009605, GO:0044708, GO:0007584, GO:0031667, GO:0007610, GO:0051780, GO:0008150, GO:0042221, GO:0050896
GO:0030431 [BP]sleepprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0009584 [BP]detection of visible lightprobableGO:0009581, GO:0009582, GO:0009583, GO:0051606, GO:0009605, GO:0009628, GO:0009314, GO:0050896, GO:0009416, GO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R9R, chain B
Confidence level:very confident
Coverage over the Query: 9-152,169-212
View the alignment between query and template
View the model in PyMOL
Template: 4DXW, chain A
Confidence level:confident
Coverage over the Query: 44-71,92-145,182-267
View the alignment between query and template
View the model in PyMOL