Diaphorina citri psyllid: psy3211


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MSNHMFSLYFDDKSSSGLQEQEDYLEYYRHDLGINLFHYHWHEANPFAGNLVGNHRRGESFYYMHQQMLARQSYGLECGVHLGS
ccccCEEEEEcccccccccccccEEEEEEEcccccEEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHccccccccc
***HMFSLYFDDKSSSGLQEQEDYLEYYRHDLGINLFHYHWHEANPFAGNLVGNHRRGESFYYMHQQMLARQSYGLECGVH***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNHMFSLYFDDKSSSGLQEQEDYLEYYRHDLGINLFHYHWHEANPFAGNLVGNHRRGESFYYMHQQMLARQSYGLECGVHLGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0036264 [MF]dopamine monooxygenase activityprobableGO:0003824, GO:0003674, GO:0004097, GO:0016679, GO:0016682, GO:0016491
GO:0036263 [MF]L-DOPA monooxygenase activityprobableGO:0003824, GO:0003674, GO:0004097, GO:0016679, GO:0016682, GO:0016491
GO:0006583 [BP]melanin biosynthetic process from tyrosineprobableGO:0019752, GO:0044249, GO:0006807, GO:0044281, GO:1901362, GO:1901360, GO:1901576, GO:0044710, GO:0044711, GO:0042440, GO:0044550, GO:0006520, GO:0071704, GO:1901605, GO:0019748, GO:0046189, GO:0006582, GO:0006725, GO:0009058, GO:0008150, GO:0042438, GO:0008152, GO:0043436, GO:0018958, GO:0046148, GO:0009072, GO:0006570, GO:0044238, GO:1901564, GO:0006082, GO:0044237, GO:0019438, GO:0009987, GO:1901617, GO:1901615
GO:0006952 [BP]defense responseprobableGO:0006950, GO:0008150, GO:0050896
GO:0004503 [MF]monophenol monooxygenase activityprobableGO:0004497, GO:0016716, GO:0016705, GO:0003824, GO:0003674, GO:0016491
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HHS, chain A
Confidence level:very confident
Coverage over the Query: 5-81
View the alignment between query and template
View the model in PyMOL