Psyllid ID: psy3211


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MSNHMFSLYFDDKSSSGLQEQEDYLEYYRHDLGINLFHYHWHEANPFAGNLVGNHRRGESFYYMHQQMLARQSYGLECGVHLGS
ccccEEEEEEcccccccccccccEEEEEEEcccccEEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHccccccccc
cccccccEEEEcccccccccHHHHEEEEHHccccccccEEEEEEcccccccccccccHHHHHHHHHHHHHHccHHHHHHccccc
msnhmfslyfddksssglqeQEDYLEYYRHDLGINLFHYHwheanpfagnlvgnhrrgeSFYYMHQQMLARQSYGlecgvhlgs
msnhmfslyfddksssgLQEQEDYLEYYRHDLGINLFHYHWHEANPFAGNLVGNHRRGESFYYMHQQMLARQSYGLECGVHLGS
MSNHMFSLYFDDKSSSGLQEQEDYLEYYRHDLGINLFHYHWHEANPFAGNLVGNHRRGESFYYMHQQMLARQSYGLECGVHLGS
**********************DYLEYYRHDLGINLFHYHWHEANPFAGNLVGNHRRGESFYYMHQQMLARQSYGLECGVH***
***HMFSLYFDDKSSSGLQEQEDYLEYYRHDLGINLFHYHWHEANPFAGNLVGNHRRGESFYYMHQQMLARQSYGLECGVH***
MSNHMFSLYFDDKSSSGLQEQEDYLEYYRHDLGINLFHYHWHEANPFAGNLVGNHRRGESFYYMHQQMLARQSYGLECGVHLGS
*****FSLYFDDKSSSGLQEQEDYLEYYRHDLGINLFHYHWHEANPFAGNLVGNHRRGESFYYMHQQMLARQSYGLECGVHL**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNHMFSLYFDDKSSSGLQEQEDYLEYYRHDLGINLFHYHWHEANPFAGNLVGNHRRGESFYYMHQQMLARQSYGLECGVHLGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query84 2.2.26 [Sep-21-2011]
Q27452 693 Phenoloxidase subunit 2 O N/A N/A 0.619 0.075 0.563 9e-13
Q25519 695 Phenoloxidase subunit 2 O N/A N/A 0.619 0.074 0.545 3e-12
O44249 685 Phenoloxidase subunit 1 O N/A N/A 0.761 0.093 0.432 1e-10
Q27451 685 Phenoloxidase subunit 1 O N/A N/A 0.702 0.086 0.483 3e-10
Q9V521 684 Phenoloxidase subunit A3 no N/A 0.702 0.086 0.523 3e-10
Q9W1V6 683 Diphenoloxidase subunit A no N/A 0.559 0.068 0.54 4e-09
Q9NFL6 629 Hemocyanin C chain OS=Aph N/A N/A 0.761 0.101 0.441 5e-09
Q8I1F6 683 Diphenoloxidase subunit A N/A N/A 0.559 0.068 0.54 8e-09
P14750 631 Hemocyanin A chain OS=Aph N/A N/A 0.738 0.098 0.414 4e-08
P04253 628 Hemocyanin II OS=Limulus N/A N/A 0.773 0.103 0.420 7e-08
>sp|Q27452|PRP2_BOMMO Phenoloxidase subunit 2 OS=Bombyx mori PE=1 SV=2 Back     alignment and function desciption
 Score = 72.0 bits (175), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 3/55 (5%)

Query: 20  EQEDYLEYYRHDLGINLFHYHWHEANPFAGN---LVGNHRRGESFYYMHQQMLAR 71
           E+E  L Y+R D+GINL HYHWH   PF  N   +V   RRGE F+YMHQQ++AR
Sbjct: 195 EEEHRLAYWREDIGINLHHYHWHLVYPFTANDLSIVAKDRRGELFFYMHQQVIAR 249




This is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. Catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6 dihydroxyindole to indole-5'6 quinone.
Bombyx mori (taxid: 7091)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 8EC: .EC: 1
>sp|Q25519|PRP2_MANSE Phenoloxidase subunit 2 OS=Manduca sexta GN=ppo PE=1 SV=3 Back     alignment and function description
>sp|O44249|PRP1_MANSE Phenoloxidase subunit 1 OS=Manduca sexta PE=1 SV=3 Back     alignment and function description
>sp|Q27451|PRP1_BOMMO Phenoloxidase subunit 1 OS=Bombyx mori PE=1 SV=2 Back     alignment and function description
>sp|Q9V521|PRPA3_DROME Phenoloxidase subunit A3 OS=Drosophila melanogaster GN=proPo-A3 PE=1 SV=1 Back     alignment and function description
>sp|Q9W1V6|PRPD3_DROME Diphenoloxidase subunit A3 OS=Drosophila melanogaster GN=Dox-A3 PE=1 SV=1 Back     alignment and function description
>sp|Q9NFL6|HCYC_APHCL Hemocyanin C chain OS=Aphonopelma californicum GN=HCC PE=2 SV=3 Back     alignment and function description
>sp|Q8I1F6|PRPD3_DROER Diphenoloxidase subunit A3 OS=Drosophila erecta GN=Dox-A3 PE=3 SV=2 Back     alignment and function description
>sp|P14750|HCYA_APHCL Hemocyanin A chain OS=Aphonopelma californicum GN=HCA PE=1 SV=3 Back     alignment and function description
>sp|P04253|HCY2_LIMPO Hemocyanin II OS=Limulus polyphemus PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
189238603 754 PREDICTED: similar to pro-phenol oxidase 0.785 0.087 0.521 1e-11
442556963 684 prophenoloxidase [Tenebrio molitor] 0.785 0.096 0.521 1e-11
442556961 684 prophenoloxidase [Tenebrio molitor] 0.785 0.096 0.521 1e-11
270009192 332 hypothetical protein TcasGA2_TC015848 [T 0.785 0.198 0.521 1e-11
4514633 684 prophenoloxidase [Tenebrio molitor] 0.785 0.096 0.521 1e-11
270009214 683 hypothetical protein TcasGA2_TC014907 [T 0.785 0.096 0.521 2e-11
86515394 683 pro-phenol oxidase subunit 2 [Tribolium 0.785 0.096 0.521 2e-11
383863276 693 PREDICTED: phenoloxidase subunit A3-like 0.702 0.085 0.548 2e-11
157956449 693 prophenoloxidase subunit 2 [Bombyx manda 0.619 0.075 0.563 4e-11
112983448 693 phenoloxidase subunit 2 precursor [Bomby 0.619 0.075 0.563 4e-11
>gi|189238603|ref|XP_967179.2| PREDICTED: similar to pro-phenol oxidase subunit 2 [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 73.9 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 3/69 (4%)

Query: 12  DKSSSGLQEQEDYLEYYRHDLGINLFHYHWHEANPF--AGNLVGNHRRGESFYYMHQQML 69
           D ++S L+E E  L Y+R DLGINL H+HWH   PF  A  +V  +RRGE FYYMHQQ++
Sbjct: 253 DYTASDLEE-EHRLAYFREDLGINLHHWHWHLVYPFEAAREVVAKNRRGELFYYMHQQII 311

Query: 70  ARQSYGLEC 78
           AR ++   C
Sbjct: 312 ARYNFERLC 320




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|442556963|gb|AGC54940.1| prophenoloxidase [Tenebrio molitor] Back     alignment and taxonomy information
>gi|442556961|gb|AGC54939.1| prophenoloxidase [Tenebrio molitor] Back     alignment and taxonomy information
>gi|270009192|gb|EFA05640.1| hypothetical protein TcasGA2_TC015848 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|4514633|dbj|BAA75470.1| prophenoloxidase [Tenebrio molitor] Back     alignment and taxonomy information
>gi|270009214|gb|EFA05662.1| hypothetical protein TcasGA2_TC014907 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|86515394|ref|NP_001034522.1| pro-phenol oxidase subunit 2 [Tribolium castaneum] gi|70999576|gb|AAX84205.1| pro-phenol oxidase subunit 2 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383863276|ref|XP_003707107.1| PREDICTED: phenoloxidase subunit A3-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|157956449|gb|ABW06580.1| prophenoloxidase subunit 2 [Bombyx mandarina] Back     alignment and taxonomy information
>gi|112983448|ref|NP_001037534.1| phenoloxidase subunit 2 precursor [Bombyx mori] gi|46396763|sp|Q27452.2|PRP2_BOMMO RecName: Full=Phenoloxidase subunit 2; AltName: Full=PO 2; AltName: Full=Tyrosinase 2; Flags: Precursor gi|994751|dbj|BAA08369.1| prophenoloxidase subunit 2 [Bombyx mori] gi|13646950|dbj|BAB41101.1| prophenoloxidase-2f [Bombyx mori] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
UNIPROTKB|Q27452 693 Q27452 "Phenoloxidase subunit 0.702 0.085 0.523 6e-12
UNIPROTKB|Q25519 695 ppo "Phenoloxidase subunit 2" 0.702 0.084 0.507 3.4e-11
FB|FBgn0033367 684 proPO45 "prophenoloxidase 45" 0.702 0.086 0.523 5.5e-11
UNIPROTKB|Q27451 685 Q27451 "Phenoloxidase subunit 0.666 0.081 0.524 1.1e-10
UNIPROTKB|O44249 685 O44249 "Phenoloxidase subunit 0.666 0.081 0.491 2.4e-10
FB|FBgn0261362 690 proPO-A1 "prophenol oxidase A1 0.678 0.082 0.491 3.1e-10
UNIPROTKB|Q9NFL6 629 HCC "Hemocyanin C chain" [Apho 0.714 0.095 0.476 9.4e-10
FB|FBgn0261363 683 proPO59 "prophenoloxidase 59" 0.595 0.073 0.528 1.3e-09
UNIPROTKB|P80476 626 P80476 "Hemocyanin AA6 chain" 0.833 0.111 0.407 2.5e-09
UNIPROTKB|P04253 628 P04253 "Hemocyanin II" [Limulu 0.845 0.113 0.434 4.1e-09
UNIPROTKB|Q27452 Q27452 "Phenoloxidase subunit 2" [Bombyx mori (taxid:7091)] Back     alignment and assigned GO terms
 Score = 172 (65.6 bits), Expect = 6.0e-12, P = 6.0e-12
 Identities = 33/63 (52%), Positives = 43/63 (68%)

Query:    12 DKSSSGLQEQEDYLEYYRHDLGINLFHYHWHEANPFAGN---LVGNHRRGESFYYMHQQM 68
             D +++ L+E E  L Y+R D+GINL HYHWH   PF  N   +V   RRGE F+YMHQQ+
Sbjct:   188 DYTATDLEE-EHRLAYWREDIGINLHHYHWHLVYPFTANDLSIVAKDRRGELFFYMHQQV 246

Query:    69 LAR 71
             +AR
Sbjct:   247 IAR 249




GO:0004503 "monophenol monooxygenase activity" evidence=TAS
GO:0005576 "extracellular region" evidence=TAS
GO:0006583 "melanin biosynthetic process from tyrosine" evidence=TAS
GO:0006952 "defense response" evidence=TAS
UNIPROTKB|Q25519 ppo "Phenoloxidase subunit 2" [Manduca sexta (taxid:7130)] Back     alignment and assigned GO terms
FB|FBgn0033367 proPO45 "prophenoloxidase 45" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q27451 Q27451 "Phenoloxidase subunit 1" [Bombyx mori (taxid:7091)] Back     alignment and assigned GO terms
UNIPROTKB|O44249 O44249 "Phenoloxidase subunit 1" [Manduca sexta (taxid:7130)] Back     alignment and assigned GO terms
FB|FBgn0261362 proPO-A1 "prophenol oxidase A1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NFL6 HCC "Hemocyanin C chain" [Aphonopelma sp. (taxid:29932)] Back     alignment and assigned GO terms
FB|FBgn0261363 proPO59 "prophenoloxidase 59" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P80476 P80476 "Hemocyanin AA6 chain" [Androctonus australis (taxid:6858)] Back     alignment and assigned GO terms
UNIPROTKB|P04253 P04253 "Hemocyanin II" [Limulus polyphemus (taxid:6850)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
pfam00372 278 pfam00372, Hemocyanin_M, Hemocyanin, copper contai 9e-12
>gnl|CDD|215881 pfam00372, Hemocyanin_M, Hemocyanin, copper containing domain Back     alignment and domain information
 Score = 58.1 bits (141), Expect = 9e-12
 Identities = 28/64 (43%), Positives = 40/64 (62%), Gaps = 4/64 (6%)

Query: 12  DKSSSGLQEQEDYLEYYRHDLGINLFHYHWHEANPF--AGNLVGNH--RRGESFYYMHQQ 67
           + + + L  +E  L Y+  D+G+N +HY+WH   PF    +  G +  RRGE FYYMHQQ
Sbjct: 52  NYTGNILYNEEYRLAYFTEDIGLNTYHYYWHMVYPFWWDDDFYGKNKDRRGELFYYMHQQ 111

Query: 68  MLAR 71
           +LAR
Sbjct: 112 LLAR 115


This family includes arthropod hemocyanins and insect larval storage proteins. Length = 278

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 84
PF00372 278 Hemocyanin_M: Hemocyanin, copper containing domain 100.0
>PF00372 Hemocyanin_M: Hemocyanin, copper containing domain; InterPro: IPR000896 Haemocyanins are copper-containing oxygen transport proteins found in the haemolymph of many invertebrates Back     alignment and domain information
Probab=100.00  E-value=5.8e-40  Score=249.14  Aligned_cols=75  Identities=35%  Similarity=0.567  Sum_probs=68.1

Q ss_pred             EEEEecCCCCCCC-CCCceeceehhhhchhHHHHHHHhhCCCCCC----CCCcccchhhhHHHHHHHHHHHhhhhhcCCC
Q psy3211           7 SLYFDDKSSSGLQ-EQEDYLEYYRHDLGINLFHYHWHEANPFAGN----LVGNHRRGESFYYMHQQMLARQSYGLECGVH   81 (84)
Q Consensus         7 ~~~i~~nyt~~~~-~~e~~LsYFtEDigLN~yy~~~h~~yP~w~~----~~~~~RrGElf~y~hqQllARY~LERlSn~~   81 (84)
                      .++||+|||++.. ++|++||||||||||||||++||++||+|+.    +..|+||||+||||||||||||+|||||||.
T Consensus        46 ~~vi~~nyt~~~~~~~E~~LsYFtEDIGLNs~~~~~h~~yP~w~~~~~~~~~kdRrGElfyY~h~QlLARY~lERlSngL  125 (278)
T PF00372_consen   46 PVVIPANYTGWYTQNPEQKLSYFTEDIGLNSYYYYWHLVYPFWMNGEEYGLNKDRRGELFYYMHQQLLARYYLERLSNGL  125 (278)
T ss_dssp             EEEEESTSSSGTTSSGGGGGHHHHT-HHHHHHHHHHHHHS-TTBSSHHHSSHHTTHHHHHHHHHHHHHHHHHHHHHHTT-
T ss_pred             eeEEeccccccccCChhHhHHHHhhcccHHHHHHHHHhcCcccccccccccccccchhhhHHHHHHHHHHHHHHHhccCC
Confidence            5899999999855 8999999999999999999999999999983    5789999999999999999999999999984



They are divided into 2 main groups, arthropodan and molluscan. These have structurally similar oxygen-binding centres, which are similar to the oxygen-binding centre of tyrosinases [], but their quaternary structures are arranged differently. The arthropodan proteins exist as hexamers comprising 3 heterogeneous subunits (a, b and c) and possess 1 oxygen-binding centre per subunit; and the molluscan proteins exist as cylindrical oligomers of 10 to 20 subunits and possess 7 or 8 oxygen-binding centres per subunit []. Although the proteins have similar amino acid compositions, the only real similarity in their primary sequences is in the region corresponding to the second copper-binding domain, which also shows similarity to the copper-binding domain of tyrosinases []. Larval storage proteins (LSP) [] are proteins from the hemolymph of insects, which may serve as a store of amino acids for synthesis of adult proteins. There are two classes of LSP's, arylphorins, which are rich in aromatic amino acids, and methionine-rich LSP's. LSP's forms hexameric complexes. LSP's are structurally related to arthropods hemocyanins. This entry represents the copper-containg domain that usually occurs in the centre of haemocyanin proteins.; GO: 0005344 oxygen transporter activity, 0006810 transport; PDB: 1HCY_A 1HC1_C 3IXV_E 3IXW_L 3GWJ_F 3HHS_A 1NOL_A 1LLA_A 1OXY_A 1LL1_A.


Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
3hhs_A 694 Crystal Structure Of Manduca Sexta Prophenoloxidase 3e-13
3hhs_B 684 Crystal Structure Of Manduca Sexta Prophenoloxidase 8e-12
1oxy_A 628 Crystallographic Analysis Of Oxygenated And Deoxyge 6e-09
1lla_A 628 Crystal Structure Of Deoxygenated Limulus Polyphemu 6e-09
1ll1_A 628 Hydroxo Bridge Met Form Hemocyanin From Limulus Len 6e-09
3ixv_A 626 Scorpion Hemocyanin Resting State Pseudo Atomic Mod 7e-09
>pdb|3HHS|A Chain A, Crystal Structure Of Manduca Sexta Prophenoloxidase Length = 694 Back     alignment and structure

Iteration: 1

Score = 70.1 bits (170), Expect = 3e-13, Method: Composition-based stats. Identities = 30/55 (54%), Positives = 39/55 (70%), Gaps = 3/55 (5%) Query: 20 EQEDYLEYYRHDLGINLFHYHWHEANPFAGN---LVGNHRRGESFYYMHQQMLAR 71 E+E L Y+R DLGINL H+HWH PF+ + +V RRGE F+YMHQQ++AR Sbjct: 196 EEEHRLAYWREDLGINLHHWHWHLVYPFSASDEKIVAKDRRGELFFYMHQQIIAR 250
>pdb|3HHS|B Chain B, Crystal Structure Of Manduca Sexta Prophenoloxidase Length = 684 Back     alignment and structure
>pdb|1OXY|A Chain A, Crystallographic Analysis Of Oxygenated And Deoxygenated States Of Arthropod Hemocyanin Shows Unusual Differences Length = 628 Back     alignment and structure
>pdb|1LLA|A Chain A, Crystal Structure Of Deoxygenated Limulus Polyphemus Subunit Ii Hemocyanin At 2.18 Angstroms Resolution: Clues For A Mechanism For Allosteric Regulation Length = 628 Back     alignment and structure
>pdb|1LL1|A Chain A, Hydroxo Bridge Met Form Hemocyanin From Limulus Length = 628 Back     alignment and structure
>pdb|3IXV|A Chain A, Scorpion Hemocyanin Resting State Pseudo Atomic Model Built Cryo-Em Density Map Length = 626 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
3hhs_B 684 Propo-P1, phenoloxidase subunit 1; alpha helix, be 1e-13
3hhs_A 694 Propo-P2, phenoloxidase subunit 2; alpha helix, be 1e-13
1lla_A 628 Hemocyanin (subunit type II); oxygen transport; 2. 3e-13
1hc1_A 657 Arthropodan hemocyanin; oxygen transport; 3.20A {P 7e-13
3gwj_A 674 Arylphorin; mono-glucosylated N-glycan, stability, 2e-12
3ixv_A 626 Hemocyanin AA6 chain; HC, phenolxoidase activity, 4e-12
>3hhs_B Propo-P1, phenoloxidase subunit 1; alpha helix, beta strand, melanin biosynthesis, metal-bindin monooxygenase, oxidoreductase, secreted; 1.97A {Manduca sexta} Length = 684 Back     alignment and structure
 Score = 63.5 bits (154), Expect = 1e-13
 Identities = 29/59 (49%), Positives = 37/59 (62%), Gaps = 5/59 (8%)

Query: 22  EDYLEYYRHDLGINLFHYHWHEANPFAGN---LVGNHRRGESFYYMHQQMLARQSYGLE 77
           E  + Y+R D+GINL H+HWH   PF      +V   RRGE FYYMHQQ++ R  Y +E
Sbjct: 192 EQRVAYFREDIGINLHHWHWHLVYPFDSADRSIVNKDRRGELFYYMHQQIIGR--YNVE 248


>3hhs_A Propo-P2, phenoloxidase subunit 2; alpha helix, beta strand, melanin biosynthesis, metal-bindin monooxygenase, oxidoreductase, secreted; 1.97A {Manduca sexta} Length = 694 Back     alignment and structure
>1lla_A Hemocyanin (subunit type II); oxygen transport; 2.18A {Limulus polyphemus} SCOP: a.85.1.1 a.86.1.1 b.1.18.3 PDB: 1nol_A 1ll1_A 1oxy_A Length = 628 Back     alignment and structure
>1hc1_A Arthropodan hemocyanin; oxygen transport; 3.20A {Panulirus interruptus} SCOP: a.85.1.1 a.86.1.1 b.1.18.3 PDB: 1hc2_A 1hc3_A 1hc4_A 1hc5_A 1hc6_A 1hcy_A* Length = 657 Back     alignment and structure
>3gwj_A Arylphorin; mono-glucosylated N-glycan, stability, glycosyla glycoprotein, secreted, storage protein, oxygen transport; HET: NAG BMA MAN GLC; 2.43A {Antheraea pernyi} Length = 674 Back     alignment and structure
>3ixv_A Hemocyanin AA6 chain; HC, phenolxoidase activity, tyrosinase (TY), catecholoxidase (CO), enzyme, SDS, cryo-EM, single particle analysis; 6.80A {Androctonus australis} PDB: 3ixw_A Length = 626 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query84
3ixv_A 626 Hemocyanin AA6 chain; HC, phenolxoidase activity, 100.0
1lla_A 628 Hemocyanin (subunit type II); oxygen transport; 2. 100.0
1hc1_A 657 Arthropodan hemocyanin; oxygen transport; 3.20A {P 100.0
3hhs_A 694 Propo-P2, phenoloxidase subunit 2; alpha helix, be 100.0
3hhs_B 684 Propo-P1, phenoloxidase subunit 1; alpha helix, be 100.0
3gwj_A 674 Arylphorin; mono-glucosylated N-glycan, stability, 100.0
>3ixv_A Hemocyanin AA6 chain; HC, phenolxoidase activity, tyrosinase (TY), catecholoxidase (CO), enzyme, SDS, cryo-EM, single particle analysis; 6.80A {Androctonus australis} PDB: 3ixw_A Back     alignment and structure
Probab=100.00  E-value=7.5e-38  Score=257.94  Aligned_cols=76  Identities=34%  Similarity=0.555  Sum_probs=72.1

Q ss_pred             eEEEEecCCCCCCCCCCceeceehhhhchhHHHHHHHhhCCCCC----CCCCcccchhhhHHHHHHHHHHHhhhhhcCCC
Q psy3211           6 FSLYFDDKSSSGLQEQEDYLEYYRHDLGINLFHYHWHEANPFAG----NLVGNHRRGESFYYMHQQMLARQSYGLECGVH   81 (84)
Q Consensus         6 ~~~~i~~nyt~~~~~~e~~LsYFtEDigLN~yy~~~h~~yP~w~----~~~~~~RrGElf~y~hqQllARY~LERlSn~~   81 (84)
                      .+++||+||||+..++|++||||||||||||||||||++||+|+    .+..||||||+||||||||||||+|||||||.
T Consensus       138 ~~~~i~~nyt~~~~~~E~rlaYF~EDiGlNshh~~whl~YP~~~~~~~~~~~kdRrGElfyYmhqQllARY~lERLSNgL  217 (626)
T 3ixv_A          138 QSIVVEAEETGNILDPEYKLSYFREDIGINAHHWHWHIVYPATWNPTVMGKEKDRKGELFFYMHQQMCARYDSERLSNGL  217 (626)
T ss_dssp             SCEEEETTCCCCCCCGGGGGHHHHTCHHHHHHHHHHHHHSCTTCCHHHHSCCCTTHHHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             ccEEEeecCCCCCCCccceehhhhccccHHHHHHHHHeeCCcccChhhccCcccccchhHHHHHHHHHHHHhHHhhcCCC
Confidence            46899999999999999999999999999999999999999998    36789999999999999999999999999985



>1lla_A Hemocyanin (subunit type II); oxygen transport; 2.18A {Limulus polyphemus} SCOP: a.85.1.1 a.86.1.1 b.1.18.3 PDB: 1nol_A 1ll1_A 1oxy_A Back     alignment and structure
>1hc1_A Arthropodan hemocyanin; oxygen transport; 3.20A {Panulirus interruptus} SCOP: a.85.1.1 a.86.1.1 b.1.18.3 PDB: 1hc2_A 1hc3_A 1hc4_A 1hc5_A 1hc6_A 1hcy_A* Back     alignment and structure
>3hhs_A Propo-P2, phenoloxidase subunit 2; alpha helix, beta strand, melanin biosynthesis, metal-bindin monooxygenase, oxidoreductase, secreted; 1.97A {Manduca sexta} Back     alignment and structure
>3hhs_B Propo-P1, phenoloxidase subunit 1; alpha helix, beta strand, melanin biosynthesis, metal-bindin monooxygenase, oxidoreductase, secreted; 1.97A {Manduca sexta} Back     alignment and structure
>3gwj_A Arylphorin; mono-glucosylated N-glycan, stability, glycosyla glycoprotein, secreted, storage protein, oxygen transport; HET: NAG BMA MAN GLC; 2.43A {Antheraea pernyi} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 84
d1hc1a2 263 a.86.1.1 (A:136-398) Arthropod hemocyanin {Spiny l 1e-14
d1llaa2 270 a.86.1.1 (A:110-379) Arthropod hemocyanin {Horsesh 1e-13
>d1hc1a2 a.86.1.1 (A:136-398) Arthropod hemocyanin {Spiny lobster (Panulirus interruptus) [TaxId: 6735]} Length = 263 Back     information, alignment and structure

class: All alpha proteins
fold: Di-copper centre-containing domain
superfamily: Di-copper centre-containing domain
family: Hemocyanin middle domain
domain: Arthropod hemocyanin
species: Spiny lobster (Panulirus interruptus) [TaxId: 6735]
 Score = 64.3 bits (157), Expect = 1e-14
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 5/61 (8%)

Query: 20 EQEDYLEYYRHDLGINLFHYHWHEANPFAGN---LVGNHRRGESFYYMHQQMLARQSYGL 76
           +E  + Y+  D+G+N+ H  WH   PF           R+GE F+++H Q+ AR  +  
Sbjct: 41 NREQRVAYFGEDIGMNIHHVTWHMDFPFWWEDSYGYHLDRKGELFFWVHHQLTAR--FDF 98

Query: 77 E 77
          E
Sbjct: 99 E 99


>d1llaa2 a.86.1.1 (A:110-379) Arthropod hemocyanin {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]} Length = 270 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query84
d1llaa2 270 Arthropod hemocyanin {Horseshoe crab (Limulus poly 100.0
d1hc1a2 263 Arthropod hemocyanin {Spiny lobster (Panulirus int 100.0
>d1llaa2 a.86.1.1 (A:110-379) Arthropod hemocyanin {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]} Back     information, alignment and structure
class: All alpha proteins
fold: Di-copper centre-containing domain
superfamily: Di-copper centre-containing domain
family: Hemocyanin middle domain
domain: Arthropod hemocyanin
species: Horseshoe crab (Limulus polyphemus) [TaxId: 6850]
Probab=100.00  E-value=2.9e-41  Score=253.29  Aligned_cols=76  Identities=37%  Similarity=0.572  Sum_probs=70.3

Q ss_pred             eEEEEecCCCCCCCCCCceeceehhhhchhHHHHHHHhhCCCCC----CCCCcccchhhhHHHHHHHHHHHhhhhhcCCC
Q psy3211           6 FSLYFDDKSSSGLQEQEDYLEYYRHDLGINLFHYHWHEANPFAG----NLVGNHRRGESFYYMHQQMLARQSYGLECGVH   81 (84)
Q Consensus         6 ~~~~i~~nyt~~~~~~e~~LsYFtEDigLN~yy~~~h~~yP~w~----~~~~~~RrGElf~y~hqQllARY~LERlSn~~   81 (84)
                      .+++||+|||++..++|++||||||||||||||+|||++||+|+    .++.||||||+|||+||||||||+|||||||.
T Consensus        32 ~~~~i~~nyt~~~~~~E~~lsYFtEDiGlNsyyyy~h~~yP~w~~~~~~~~~kdRRGElfyy~hqQLLARY~lERLsngL  111 (270)
T d1llaa2          32 SPILVDVQDTGNILDPEYRLAYYREDVGINAHHWHWHLVYPSTWNPKYFGKKKDRKGELFYYMHQQMCARYDCERLSNGM  111 (270)
T ss_dssp             CCEEEEC--CCCCCCGGGGGHHHHTCHHHHHHHHHHHHHSCTTCCHHHHSCCCTTHHHHHHHHHHHHHHHHHHHHHHTTC
T ss_pred             eeEEEeeccccccCChhhhhhHHHhhcCHHHHHHHHHccCCCcCCccccccccccchhHHHHHHHHHHHHHHHHHHhCCC
Confidence            46899999999999999999999999999999999999999998    36789999999999999999999999999984



>d1hc1a2 a.86.1.1 (A:136-398) Arthropod hemocyanin {Spiny lobster (Panulirus interruptus) [TaxId: 6735]} Back     information, alignment and structure