Diaphorina citri psyllid: psy3212


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MRSSYQAQYYGTISLGTPPQEFKVIFDTGSSNLWIPSQHCSILNIACSVDKDKFVGHSHFRNASDENGGEIMFGGVDKDKFVGDITYSPVSRKGYWQFGVESIKIEKNVYCSNCQAIADTGTSLIIGPSKVIAELNKLIGAVPLANGPAKVDCDNLDKMPNVDIILGGKNFTLTRTN
cccccccEEEEEEEEccccccEEEEEEccccccccccccccHHHHccccccccEEEEccccccccccccEEEEcccccccEEEEcEEEEccEEEEEEEEEcEEEEccEEEcccEEEEECcccccccccHHHHHHHHHHHcccccccccEEECcccccccccEEEEEccEEEEccccc
MRSSYQAQYYGTISLGTPPQEFKVIFDTGSSNLWIPSQHCSILNIACSVDKDKFVGHSHFRNASDENGGEIMFGGVDKDKFVGDITYSPVSRKGYWQFGVESIKIEKNVYCSNCQAIADTGTSLIIGPSKVIAELNKLIGAVPLANGPAKVDCDNLDKMPNVDIILGGKNFTL****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSSYQAQYYGTISLGTPPQEFKVIFDTGSSNLWIPSQHCSILNIACSVDKDKFVGHSHFRNASDENGGEIMFGGVDKDKFVGDITYSPVSRKGYWQFGVESIKIEKNVYCSNCQAIADTGTSLIIGPSKVIAELNKLIGAVPLANGPAKVDCDNLDKMPNVDIILGGKNFTLTRTN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004190 [MF]aspartic-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0070001, GO:0003824, GO:0070011, GO:0003674, GO:0008233
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QDM, chain A
Confidence level:very confident
Coverage over the Query: 1-141
View the alignment between query and template
View the model in PyMOL
Template: 2X0B, chain A
Confidence level:very confident
Coverage over the Query: 1-177
View the alignment between query and template
View the model in PyMOL