Psyllid ID: psy3212
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 177 | ||||||
| 326433118 | 385 | cathepsin D [Salpingoeca sp. ATCC 50818] | 0.621 | 0.285 | 0.517 | 2e-28 | |
| 307203870 | 374 | Lysosomal aspartic protease [Harpegnatho | 0.644 | 0.304 | 0.521 | 3e-28 | |
| 170063951 | 387 | lysosomal aspartic protease [Culex quinq | 0.638 | 0.291 | 0.508 | 4e-27 | |
| 391329068 | 384 | PREDICTED: lysosomal aspartic protease-l | 0.644 | 0.296 | 0.533 | 7e-27 | |
| 427789779 | 391 | Putative cathepsin d isoform 1 protein [ | 0.638 | 0.289 | 0.513 | 9e-27 | |
| 241275826 | 345 | aspartic protease, putative [Ixodes scap | 0.638 | 0.327 | 0.504 | 1e-26 | |
| 227018334 | 386 | aspartic proteinase 1 [Chrysomela tremul | 0.644 | 0.295 | 0.513 | 2e-26 | |
| 315274244 | 387 | cathepsin D2 [Ixodes ricinus] | 0.638 | 0.291 | 0.504 | 3e-26 | |
| 347451476 | 393 | aspartate protease cathepsin D [Triatoma | 0.638 | 0.287 | 0.473 | 3e-26 | |
| 293230 | 387 | aspartic protease [Aedes aegypti] | 0.638 | 0.291 | 0.5 | 4e-26 |
| >gi|326433118|gb|EGD78688.1| cathepsin D [Salpingoeca sp. ATCC 50818] | Back alignment and taxonomy information |
|---|
Score = 130 bits (327), Expect = 2e-28, Method: Compositional matrix adjust.
Identities = 59/114 (51%), Positives = 77/114 (67%)
Query: 61 RNASDENGGEIMFGGVDKDKFVGDITYSPVSRKGYWQFGVESIKIEKNVYCSNCQAIADT 120
R +GGE+ GG D G I + P++R GYWQF ++S+ + + YCSNCQAIADT
Sbjct: 212 RVQGAPSGGELTLGGYDPKHMSGPIQWVPLTRDGYWQFAMDSLSVNGDSYCSNCQAIADT 271
Query: 121 GTSLIIGPSKVIAELNKLIGAVPLANGPAKVDCDNLDKMPNVDIILGGKNFTLT 174
GTSL+ GP+ I +LNK IGA+P+A G VDC + MPNVDI+L G+ FTLT
Sbjct: 272 GTSLLAGPTDAIKKLNKQIGAIPIAQGEYMVDCKKIPTMPNVDIVLNGQKFTLT 325
|
Source: Salpingoeca sp. ATCC 50818 Species: Salpingoeca sp. ATCC 50818 Genus: Salpingoeca Family: Salpingoecidae Order: Choanoflagellida Class: Phylum: Superkingdom: Eukaryota |
| >gi|307203870|gb|EFN82801.1| Lysosomal aspartic protease [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|170063951|ref|XP_001867326.1| lysosomal aspartic protease [Culex quinquefasciatus] gi|167881401|gb|EDS44784.1| lysosomal aspartic protease [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|391329068|ref|XP_003738999.1| PREDICTED: lysosomal aspartic protease-like [Metaseiulus occidentalis] | Back alignment and taxonomy information |
|---|
| >gi|427789779|gb|JAA60341.1| Putative cathepsin d isoform 1 protein [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|241275826|ref|XP_002406708.1| aspartic protease, putative [Ixodes scapularis] gi|215496940|gb|EEC06580.1| aspartic protease, putative [Ixodes scapularis] | Back alignment and taxonomy information |
|---|
| >gi|227018334|gb|ACP18833.1| aspartic proteinase 1 [Chrysomela tremula] | Back alignment and taxonomy information |
|---|
| >gi|315274244|gb|ADU03674.1| cathepsin D2 [Ixodes ricinus] | Back alignment and taxonomy information |
|---|
| >gi|347451476|gb|AEO94539.1| aspartate protease cathepsin D [Triatoma infestans] | Back alignment and taxonomy information |
|---|
| >gi|293230|gb|AAA29350.1| aspartic protease [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 177 | ||||||
| WB|WBGene00000217 | 444 | asp-4 [Caenorhabditis elegans | 0.638 | 0.254 | 0.491 | 1.4e-41 | |
| UNIPROTKB|P00795 | 345 | CTSD "Cathepsin D" [Sus scrofa | 0.723 | 0.371 | 0.396 | 5.8e-40 | |
| UNIPROTKB|O93428 | 396 | ctsd "Cathepsin D" [Chionodrac | 0.644 | 0.287 | 0.422 | 5.6e-39 | |
| UNIPROTKB|Q05744 | 398 | CTSD "Cathepsin D" [Gallus gal | 0.706 | 0.314 | 0.390 | 8.8e-39 | |
| FB|FBgn0029093 | 392 | cathD "cathD" [Drosophila mela | 0.638 | 0.288 | 0.421 | 2.3e-38 | |
| UNIPROTKB|P80209 | 390 | CTSD "Cathepsin D" [Bos taurus | 0.694 | 0.315 | 0.392 | 8.2e-38 | |
| FB|FBgn0053128 | 405 | CG33128 [Drosophila melanogast | 0.694 | 0.303 | 0.448 | 1.1e-37 | |
| UNIPROTKB|F1MMR6 | 412 | CTSD "Cathepsin D" [Bos taurus | 0.694 | 0.298 | 0.392 | 1.7e-37 | |
| UNIPROTKB|E2RJN2 | 396 | CTSE "Uncharacterized protein" | 0.638 | 0.285 | 0.453 | 2.3e-36 | |
| FB|FBgn0038507 | 395 | CG5863 [Drosophila melanogaste | 0.638 | 0.286 | 0.433 | 2.7e-36 |
| WB|WBGene00000217 asp-4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Score = 289 (106.8 bits), Expect = 1.4e-41, Sum P(2) = 1.4e-41
Identities = 56/114 (49%), Positives = 72/114 (63%)
Query: 61 RNASDENGGEIMFGGVDKDKFVGDITYSPVSRKGYWQFGVESIKIEKNVYCSN-CQAIAD 119
RN E GGEI FGG+D ++V ITY PV+RKGYWQF ++ + + CSN CQAIAD
Sbjct: 239 RNPDSEIGGEITFGGIDSRRYVEPITYVPVTRKGYWQFKMDKVVGSGVLGCSNGCQAIAD 298
Query: 120 TGTSLIIGPSKVIAELNKLIGAVPLANGPAKVDCDNLDKMPNVDIILGGKNFTL 173
TGTSLI GP I + IGA PL G + CD + +P V ++GG+ F+L
Sbjct: 299 TGTSLIAGPKAQIEAIQNFIGAEPLIKGEYMISCDKVPTLPPVSFVIGGQEFSL 352
|
|
| UNIPROTKB|P00795 CTSD "Cathepsin D" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O93428 ctsd "Cathepsin D" [Chionodraco hamatus (taxid:36188)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q05744 CTSD "Cathepsin D" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0029093 cathD "cathD" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P80209 CTSD "Cathepsin D" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053128 CG33128 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MMR6 CTSD "Cathepsin D" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RJN2 CTSE "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0038507 CG5863 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 177 | |||
| cd05485 | 329 | cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsi | 2e-41 | |
| cd06098 | 317 | cd06098, phytepsin, Phytepsin, a plant homolog of | 5e-33 | |
| pfam00026 | 316 | pfam00026, Asp, Eukaryotic aspartyl protease | 1e-31 | |
| cd05478 | 317 | cd05478, pepsin_A, Pepsin A, aspartic protease pro | 5e-30 | |
| cd05490 | 325 | cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family | 2e-29 | |
| cd05488 | 320 | cd05488, Proteinase_A_fungi, Fungal Proteinase A , | 3e-29 | |
| cd05486 | 316 | cd05486, Cathespin_E, Cathepsin E, non-lysosomal a | 1e-28 | |
| cd05471 | 283 | cd05471, pepsin_like, Pepsin-like aspartic proteas | 4e-25 | |
| cd05477 | 318 | cd05477, gastricsin, Gastricsins, asparate proteas | 1e-24 | |
| cd05487 | 326 | cd05487, renin_like, Renin stimulates production o | 4e-21 | |
| cd05490 | 325 | cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family | 1e-20 | |
| cd05485 | 329 | cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsi | 2e-18 | |
| cd05478 | 317 | cd05478, pepsin_A, Pepsin A, aspartic protease pro | 4e-18 | |
| cd06098 | 317 | cd06098, phytepsin, Phytepsin, a plant homolog of | 4e-17 | |
| cd05487 | 326 | cd05487, renin_like, Renin stimulates production o | 4e-17 | |
| cd05488 | 320 | cd05488, Proteinase_A_fungi, Fungal Proteinase A , | 1e-16 | |
| pfam00026 | 316 | pfam00026, Asp, Eukaryotic aspartyl protease | 2e-15 | |
| PTZ00165 | 482 | PTZ00165, PTZ00165, aspartyl protease; Provisional | 2e-14 | |
| cd05471 | 283 | cd05471, pepsin_like, Pepsin-like aspartic proteas | 3e-14 | |
| PTZ00165 | 482 | PTZ00165, PTZ00165, aspartyl protease; Provisional | 4e-14 | |
| cd05486 | 316 | cd05486, Cathespin_E, Cathepsin E, non-lysosomal a | 6e-13 | |
| cd05477 | 318 | cd05477, gastricsin, Gastricsins, asparate proteas | 2e-12 | |
| cd06097 | 278 | cd06097, Aspergillopepsin_like, Aspergillopepsin_l | 6e-12 | |
| cd05470 | 109 | cd05470, pepsin_retropepsin_like, Cellular and ret | 2e-11 | |
| cd05474 | 295 | cd05474, SAP_like, SAPs, pepsin-like proteinases s | 9e-09 | |
| cd05474 | 295 | cd05474, SAP_like, SAPs, pepsin-like proteinases s | 4e-08 | |
| PTZ00013 | 450 | PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisiona | 5e-08 | |
| cd05473 | 364 | cd05473, beta_secretase_like, Beta-secretase, aspa | 8e-07 | |
| cd06097 | 278 | cd06097, Aspergillopepsin_like, Aspergillopepsin_l | 2e-06 | |
| cd05476 | 265 | cd05476, pepsin_A_like_plant, Chroloplast Nucleoid | 3e-06 | |
| PTZ00147 | 453 | PTZ00147, PTZ00147, plasmepsin-1; Provisional | 5e-06 | |
| PTZ00013 | 450 | PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisiona | 9e-06 | |
| cd05472 | 299 | cd05472, cnd41_like, Chloroplast Nucleoids DNA-bin | 3e-04 | |
| cd05473 | 364 | cd05473, beta_secretase_like, Beta-secretase, aspa | 0.002 | |
| PLN03146 | 431 | PLN03146, PLN03146, aspartyl protease family prote | 0.002 |
| >gnl|CDD|133152 cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsin family of proteinases | Back alignment and domain information |
|---|
Score = 141 bits (356), Expect = 2e-41
Identities = 55/115 (47%), Positives = 78/115 (67%), Gaps = 1/115 (0%)
Query: 61 RNASDENGGEIMFGGVDKDKFVGDITYSPVSRKGYWQFGVESIKIEKNVYCSN-CQAIAD 119
R+ S + GGE++ GG D + G+ TY PV+RKGYWQF ++S+ + + +CS CQAIAD
Sbjct: 157 RDPSAKEGGELILGGSDPKHYTGNFTYLPVTRKGYWQFKMDSVSVGEGEFCSGGCQAIAD 216
Query: 120 TGTSLIIGPSKVIAELNKLIGAVPLANGPAKVDCDNLDKMPNVDIILGGKNFTLT 174
TGTSLI GP I +LN IGA P+ G V+C + +P++ +LGGK+F+LT
Sbjct: 217 TGTSLIAGPVDEIEKLNNAIGAKPIIGGEYMVNCSAIPSLPDITFVLGGKSFSLT 271
|
Cathepsin D is the major aspartic proteinase of the lysosomal compartment where it functions in protein catabolism. It is a member of the pepsin family of proteinases. This enzyme is distinguished from other members of the pepsin family by two features that are characteristic of lysosomal hydrolases. First, mature Cathepsin D is found predominantly in a two-chain form due to a posttranslational cleavage event. Second, it contains phosphorylated, N-linked oligosaccharides that target the enzyme to lysosomes via mannose-6-phosphate receptors. Cathepsin D preferentially attacks peptide bonds flanked by bulky hydrophobic amino acids and its pH optimum is between pH 2.8 and 4.0. Two active site aspartic acid residues are essential for the catalytic activity of aspartic proteinases. Like other aspartic proteinases, Cathepsin D is a bilobed molecule; the two evolutionary related lobes are mostly made up of beta-sheets and flank a deep active site cleft. Each of the two related lobes contributes one active site aspartic acid residue and contains a single carbohydrate group. Cathepsin D is an essential enzyme. Mice deficient for proteinase cathepsin D, generated by gene targeting, develop normally during the first 2 weeks, stop thriving in the third week and die in a state of anorexia in the fourth week. The mice develop atrophy of ileal mucosa followed by other degradation of intestinal organs. In these knockout mice, lysosomal proteolysis was normal. These results suggest that vital functions of cathepsin D are exerted by limited proteolysis of proteins regulating cell growth and/or tissue homeostasis, while its contribution to bulk proteolysis in lysosomes appears to be non-critical. This family of aspartate proteases is classified by MEROPS as the peptidase family A1 (pepsin A, clan AA). Length = 329 |
| >gnl|CDD|133162 cd06098, phytepsin, Phytepsin, a plant homolog of mammalian lysosomal pepsins | Back alignment and domain information |
|---|
| >gnl|CDD|215663 pfam00026, Asp, Eukaryotic aspartyl protease | Back alignment and domain information |
|---|
| >gnl|CDD|133145 cd05478, pepsin_A, Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
| >gnl|CDD|133157 cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|133155 cd05488, Proteinase_A_fungi, Fungal Proteinase A , aspartic proteinase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|133153 cd05486, Cathespin_E, Cathepsin E, non-lysosomal aspartic protease | Back alignment and domain information |
|---|
| >gnl|CDD|133138 cd05471, pepsin_like, Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH | Back alignment and domain information |
|---|
| >gnl|CDD|133144 cd05477, gastricsin, Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >gnl|CDD|133154 cd05487, renin_like, Renin stimulates production of angiotensin and thus affects blood pressure | Back alignment and domain information |
|---|
| >gnl|CDD|133157 cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|133152 cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|133145 cd05478, pepsin_A, Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
| >gnl|CDD|133162 cd06098, phytepsin, Phytepsin, a plant homolog of mammalian lysosomal pepsins | Back alignment and domain information |
|---|
| >gnl|CDD|133154 cd05487, renin_like, Renin stimulates production of angiotensin and thus affects blood pressure | Back alignment and domain information |
|---|
| >gnl|CDD|133155 cd05488, Proteinase_A_fungi, Fungal Proteinase A , aspartic proteinase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|215663 pfam00026, Asp, Eukaryotic aspartyl protease | Back alignment and domain information |
|---|
| >gnl|CDD|240300 PTZ00165, PTZ00165, aspartyl protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133138 cd05471, pepsin_like, Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH | Back alignment and domain information |
|---|
| >gnl|CDD|240300 PTZ00165, PTZ00165, aspartyl protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133153 cd05486, Cathespin_E, Cathepsin E, non-lysosomal aspartic protease | Back alignment and domain information |
|---|
| >gnl|CDD|133144 cd05477, gastricsin, Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >gnl|CDD|133161 cd06097, Aspergillopepsin_like, Aspergillopepsin_like, aspartic proteases of fungal origin | Back alignment and domain information |
|---|
| >gnl|CDD|133137 cd05470, pepsin_retropepsin_like, Cellular and retroviral pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >gnl|CDD|133141 cd05474, SAP_like, SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133141 cd05474, SAP_like, SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins | Back alignment and domain information |
|---|
| >gnl|CDD|140051 PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133140 cd05473, beta_secretase_like, Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease | Back alignment and domain information |
|---|
| >gnl|CDD|133161 cd06097, Aspergillopepsin_like, Aspergillopepsin_like, aspartic proteases of fungal origin | Back alignment and domain information |
|---|
| >gnl|CDD|133143 cd05476, pepsin_A_like_plant, Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants | Back alignment and domain information |
|---|
| >gnl|CDD|140176 PTZ00147, PTZ00147, plasmepsin-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140051 PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133139 cd05472, cnd41_like, Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|133140 cd05473, beta_secretase_like, Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease | Back alignment and domain information |
|---|
| >gnl|CDD|178691 PLN03146, PLN03146, aspartyl protease family protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 177 | |||
| cd05478 | 317 | pepsin_A Pepsin A, aspartic protease produced in g | 100.0 | |
| cd05490 | 325 | Cathepsin_D2 Cathepsin_D2, pepsin family of protei | 100.0 | |
| cd05487 | 326 | renin_like Renin stimulates production of angioten | 100.0 | |
| cd05488 | 320 | Proteinase_A_fungi Fungal Proteinase A , aspartic | 100.0 | |
| cd05485 | 329 | Cathepsin_D_like Cathepsin_D_like, pepsin family o | 100.0 | |
| cd05486 | 316 | Cathespin_E Cathepsin E, non-lysosomal aspartic pr | 100.0 | |
| cd06098 | 317 | phytepsin Phytepsin, a plant homolog of mammalian | 100.0 | |
| cd05477 | 318 | gastricsin Gastricsins, asparate proteases produce | 100.0 | |
| PTZ00165 | 482 | aspartyl protease; Provisional | 100.0 | |
| PTZ00147 | 453 | plasmepsin-1; Provisional | 100.0 | |
| PTZ00013 | 450 | plasmepsin 4 (PM4); Provisional | 100.0 | |
| cd06097 | 278 | Aspergillopepsin_like Aspergillopepsin_like, aspar | 100.0 | |
| PF00026 | 317 | Asp: Eukaryotic aspartyl protease The Prosite entr | 100.0 | |
| KOG1339|consensus | 398 | 100.0 | ||
| cd05472 | 299 | cnd41_like Chloroplast Nucleoids DNA-binding Prote | 100.0 | |
| cd05474 | 295 | SAP_like SAPs, pepsin-like proteinases secreted fr | 99.97 | |
| cd05473 | 364 | beta_secretase_like Beta-secretase, aspartic-acid | 99.97 | |
| cd06096 | 326 | Plasmepsin_5 Plasmepsins are a class of aspartic p | 99.96 | |
| cd05471 | 283 | pepsin_like Pepsin-like aspartic proteases, biloba | 99.96 | |
| PLN03146 | 431 | aspartyl protease family protein; Provisional | 99.95 | |
| cd05476 | 265 | pepsin_A_like_plant Chroloplast Nucleoids DNA-bind | 99.95 | |
| cd05475 | 273 | nucellin_like Nucellins, plant aspartic proteases | 99.95 | |
| cd05489 | 362 | xylanase_inhibitor_I_like TAXI-I inhibits degradat | 99.9 | |
| cd05470 | 109 | pepsin_retropepsin_like Cellular and retroviral pe | 99.24 | |
| PF14541 | 161 | TAXi_C: Xylanase inhibitor C-terminal; PDB: 3AUP_D | 99.07 | |
| PF14543 | 164 | TAXi_N: Xylanase inhibitor N-terminal; PDB: 3HD8_A | 98.83 | |
| cd05483 | 96 | retropepsin_like_bacteria Bacterial aspartate prot | 97.01 | |
| cd05484 | 91 | retropepsin_like_LTR_2 Retropepsins_like_LTR, peps | 95.71 | |
| TIGR02281 | 121 | clan_AA_DTGA clan AA aspartic protease, TIGR02281 | 95.04 | |
| PF13975 | 72 | gag-asp_proteas: gag-polyprotein putative aspartyl | 94.6 | |
| TIGR02281 | 121 | clan_AA_DTGA clan AA aspartic protease, TIGR02281 | 94.54 | |
| cd05484 | 91 | retropepsin_like_LTR_2 Retropepsins_like_LTR, peps | 94.46 | |
| PF00077 | 100 | RVP: Retroviral aspartyl protease The Prosite entr | 93.23 | |
| PF13650 | 90 | Asp_protease_2: Aspartyl protease | 93.2 | |
| cd05483 | 96 | retropepsin_like_bacteria Bacterial aspartate prot | 92.5 | |
| cd05479 | 124 | RP_DDI RP_DDI; retropepsin-like domain of DNA dama | 92.39 | |
| PF13975 | 72 | gag-asp_proteas: gag-polyprotein putative aspartyl | 92.37 | |
| PF13650 | 90 | Asp_protease_2: Aspartyl protease | 91.63 | |
| cd06095 | 86 | RP_RTVL_H_like Retropepsin of the RTVL_H family of | 89.73 | |
| cd05479 | 124 | RP_DDI RP_DDI; retropepsin-like domain of DNA dama | 89.08 | |
| cd06095 | 86 | RP_RTVL_H_like Retropepsin of the RTVL_H family of | 88.64 | |
| PF12384 | 177 | Peptidase_A2B: Ty3 transposon peptidase; InterPro: | 87.16 | |
| cd05482 | 87 | HIV_retropepsin_like Retropepsins, pepsin-like asp | 86.98 | |
| TIGR03698 | 107 | clan_AA_DTGF clan AA aspartic protease, AF_0612 fa | 83.72 | |
| PF09668 | 124 | Asp_protease: Aspartyl protease; InterPro: IPR0191 | 83.25 | |
| COG3577 | 215 | Predicted aspartyl protease [General function pred | 82.51 | |
| PF00077 | 100 | RVP: Retroviral aspartyl protease The Prosite entr | 81.41 | |
| cd05481 | 93 | retropepsin_like_LTR_1 Retropepsins_like_LTR; peps | 80.03 |
| >cd05478 pepsin_A Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.1e-39 Score=254.66 Aligned_cols=175 Identities=43% Similarity=0.837 Sum_probs=151.0
Q ss_pred CccccCceEEEEEEeCCCCceEEEEEecCCCceEEeCCCCCCCCCCCCCCC-----------------------------
Q psy3212 1 MRSSYQAQYYGTISLGTPPQEFKVIFDTGSSNLWIPSQHCSILNIACSVDK----------------------------- 51 (177)
Q Consensus 1 l~~~~~~~y~~~i~iGtP~q~~~v~~DTGS~~~wv~~~~c~~~~~~c~~~~----------------------------- 51 (177)
|+|+.|.+|+++|+||||||++.|++||||+++||+|..|. ...|..+.
T Consensus 3 l~n~~~~~Y~~~i~vGtp~q~~~v~~DTGS~~~wv~~~~C~--~~~c~~~~~f~~~~Sst~~~~~~~~~~~yg~gs~~G~ 80 (317)
T cd05478 3 LTNYLDMEYYGTISIGTPPQDFTVIFDTGSSNLWVPSVYCS--SQACSNHNRFNPRQSSTYQSTGQPLSIQYGTGSMTGI 80 (317)
T ss_pred cccccCCEEEEEEEeCCCCcEEEEEEeCCCccEEEecCCCC--cccccccCcCCCCCCcceeeCCcEEEEEECCceEEEE
Confidence 78999999999999999999999999999999999999997 34564433
Q ss_pred ---C----------------------------cCCC----------------------------cccc---ccCCCCCCc
Q psy3212 52 ---D----------------------------KFVG----------------------------HSHF---RNASDENGG 69 (177)
Q Consensus 52 ---D----------------------------~fdG----------------------------~~~F---~~~~~~~~G 69 (177)
| ++|| +++| +.......|
T Consensus 81 ~~~D~v~ig~~~i~~~~fg~~~~~~~~~~~~~~~dGilGLg~~~~s~~~~~~~~~~L~~~g~i~~~~FS~~L~~~~~~~g 160 (317)
T cd05478 81 LGYDTVQVGGISDTNQIFGLSETEPGSFFYYAPFDGILGLAYPSIASSGATPVFDNMMSQGLVSQDLFSVYLSSNGQQGS 160 (317)
T ss_pred EeeeEEEECCEEECCEEEEEEEecCccccccccccceeeeccchhcccCCCCHHHHHHhCCCCCCCEEEEEeCCCCCCCe
Confidence 1 1344 2444 222333579
Q ss_pred EEEEcccCCCCeeeeeeEEecCcccceEEEEeEEEEcCeEec--CCcEEEEeCCCCcEEeCHHHHHHHHHHhCCccCCCC
Q psy3212 70 EIMFGGVDKDKFVGDITYSPVSRKGYWQFGVESIKIEKNVYC--SNCQAIADTGTSLIIGPSKVIAELNKLIGAVPLANG 147 (177)
Q Consensus 70 ~l~fGg~d~~~~~g~l~~~p~~~~~~w~v~~~~i~v~~~~~~--~~~~ai~DSGt~~~~lP~~~~~~l~~~~~~~~~~~g 147 (177)
.|+|||+|+++|.|++.|+|+....+|.|.+++++|+++.+. .+..+++||||+++++|++.+++|++++++.....+
T Consensus 161 ~l~~Gg~d~~~~~g~l~~~p~~~~~~w~v~l~~v~v~g~~~~~~~~~~~iiDTGts~~~lp~~~~~~l~~~~~~~~~~~~ 240 (317)
T cd05478 161 VVTFGGIDPSYYTGSLNWVPVTAETYWQITVDSVTINGQVVACSGGCQAIVDTGTSLLVGPSSDIANIQSDIGASQNQNG 240 (317)
T ss_pred EEEEcccCHHHccCceEEEECCCCcEEEEEeeEEEECCEEEccCCCCEEEECCCchhhhCCHHHHHHHHHHhCCccccCC
Confidence 999999999999999999999988999999999999999876 567899999999999999999999999988755678
Q ss_pred CEEEcCCCCCCCccEEEEECCEEEEeccCC
Q psy3212 148 PAKVDCDNLDKMPNVDIILGGKNFTLTRTN 177 (177)
Q Consensus 148 ~~~~~C~~~~~~p~l~f~~gg~~~~l~~~d 177 (177)
.|.++|+....+|.|+|+|+|++++|||++
T Consensus 241 ~~~~~C~~~~~~P~~~f~f~g~~~~i~~~~ 270 (317)
T cd05478 241 EMVVNCSSISSMPDVVFTINGVQYPLPPSA 270 (317)
T ss_pred cEEeCCcCcccCCcEEEEECCEEEEECHHH
Confidence 899999987789999999999999999864
|
Pepsin, a well-known aspartic protease, is produced by the human gastric mucosa in seven different zymogen isoforms, subdivided into two types: pepsinogen A and pepsinogen C. The prosequence of the zymogens are self cleaved under acidic pH. The mature enzymes are called pepsin A and pepsin C, correspondingly. The well researched porcine pepsin is also in this pepsin A family. Pepsins play an integral role in the digestion process of vertebrates. Pepsins are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localized between the two lobes of the molecule. One lobe may be evolved from the other through ancient gene-duplication event. More recently evolved enzymes have similar three-dimensional structures, however their amino acid sequences are more divergent except for the conserved catalytic site motif. Pepsins specifically cleave bonds in peptides which |
| >cd05490 Cathepsin_D2 Cathepsin_D2, pepsin family of proteinases | Back alignment and domain information |
|---|
| >cd05487 renin_like Renin stimulates production of angiotensin and thus affects blood pressure | Back alignment and domain information |
|---|
| >cd05488 Proteinase_A_fungi Fungal Proteinase A , aspartic proteinase superfamily | Back alignment and domain information |
|---|
| >cd05485 Cathepsin_D_like Cathepsin_D_like, pepsin family of proteinases | Back alignment and domain information |
|---|
| >cd05486 Cathespin_E Cathepsin E, non-lysosomal aspartic protease | Back alignment and domain information |
|---|
| >cd06098 phytepsin Phytepsin, a plant homolog of mammalian lysosomal pepsins | Back alignment and domain information |
|---|
| >cd05477 gastricsin Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >PTZ00165 aspartyl protease; Provisional | Back alignment and domain information |
|---|
| >PTZ00147 plasmepsin-1; Provisional | Back alignment and domain information |
|---|
| >PTZ00013 plasmepsin 4 (PM4); Provisional | Back alignment and domain information |
|---|
| >cd06097 Aspergillopepsin_like Aspergillopepsin_like, aspartic proteases of fungal origin | Back alignment and domain information |
|---|
| >PF00026 Asp: Eukaryotic aspartyl protease The Prosite entry also includes Pfam:PF00077 | Back alignment and domain information |
|---|
| >KOG1339|consensus | Back alignment and domain information |
|---|
| >cd05472 cnd41_like Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase | Back alignment and domain information |
|---|
| >cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins | Back alignment and domain information |
|---|
| >cd05473 beta_secretase_like Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease | Back alignment and domain information |
|---|
| >cd06096 Plasmepsin_5 Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite | Back alignment and domain information |
|---|
| >cd05471 pepsin_like Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH | Back alignment and domain information |
|---|
| >PLN03146 aspartyl protease family protein; Provisional | Back alignment and domain information |
|---|
| >cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants | Back alignment and domain information |
|---|
| >cd05475 nucellin_like Nucellins, plant aspartic proteases specifically expressed in nucellar cells during degradation | Back alignment and domain information |
|---|
| >cd05489 xylanase_inhibitor_I_like TAXI-I inhibits degradation of xylan in the cell wall | Back alignment and domain information |
|---|
| >cd05470 pepsin_retropepsin_like Cellular and retroviral pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >PF14541 TAXi_C: Xylanase inhibitor C-terminal; PDB: 3AUP_D 3HD8_A 1T6G_A 1T6E_X 2B42_A 3VLB_A 3VLA_A | Back alignment and domain information |
|---|
| >PF14543 TAXi_N: Xylanase inhibitor N-terminal; PDB: 3HD8_A 3VLB_A 3VLA_A 3AUP_D 1T6G_A 1T6E_X 2B42_A | Back alignment and domain information |
|---|
| >cd05483 retropepsin_like_bacteria Bacterial aspartate proteases, retropepsin-like protease family | Back alignment and domain information |
|---|
| >cd05484 retropepsin_like_LTR_2 Retropepsins_like_LTR, pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >TIGR02281 clan_AA_DTGA clan AA aspartic protease, TIGR02281 family | Back alignment and domain information |
|---|
| >PF13975 gag-asp_proteas: gag-polyprotein putative aspartyl protease | Back alignment and domain information |
|---|
| >TIGR02281 clan_AA_DTGA clan AA aspartic protease, TIGR02281 family | Back alignment and domain information |
|---|
| >cd05484 retropepsin_like_LTR_2 Retropepsins_like_LTR, pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >PF00077 RVP: Retroviral aspartyl protease The Prosite entry also includes Pfam:PF00026; InterPro: IPR018061 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF13650 Asp_protease_2: Aspartyl protease | Back alignment and domain information |
|---|
| >cd05483 retropepsin_like_bacteria Bacterial aspartate proteases, retropepsin-like protease family | Back alignment and domain information |
|---|
| >cd05479 RP_DDI RP_DDI; retropepsin-like domain of DNA damage inducible protein | Back alignment and domain information |
|---|
| >PF13975 gag-asp_proteas: gag-polyprotein putative aspartyl protease | Back alignment and domain information |
|---|
| >PF13650 Asp_protease_2: Aspartyl protease | Back alignment and domain information |
|---|
| >cd06095 RP_RTVL_H_like Retropepsin of the RTVL_H family of human endogenous retrovirus-like elements | Back alignment and domain information |
|---|
| >cd05479 RP_DDI RP_DDI; retropepsin-like domain of DNA damage inducible protein | Back alignment and domain information |
|---|
| >cd06095 RP_RTVL_H_like Retropepsin of the RTVL_H family of human endogenous retrovirus-like elements | Back alignment and domain information |
|---|
| >PF12384 Peptidase_A2B: Ty3 transposon peptidase; InterPro: IPR024650 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd05482 HIV_retropepsin_like Retropepsins, pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >TIGR03698 clan_AA_DTGF clan AA aspartic protease, AF_0612 family | Back alignment and domain information |
|---|
| >PF09668 Asp_protease: Aspartyl protease; InterPro: IPR019103 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG3577 Predicted aspartyl protease [General function prediction only] | Back alignment and domain information |
|---|
| >PF00077 RVP: Retroviral aspartyl protease The Prosite entry also includes Pfam:PF00026; InterPro: IPR018061 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd05481 retropepsin_like_LTR_1 Retropepsins_like_LTR; pepsin-like aspartate protease from retrotransposons with long terminal repeats | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 177 | ||||
| 1tzs_A | 351 | Crystal Structure Of An Activation Intermediate Of | 4e-21 | ||
| 1lya_B | 241 | Crystal Structures Of Native And Inhibited Forms Of | 4e-21 | ||
| 1psa_A | 326 | Structure Of A Pepsin(Slash)renin Inhibitor Complex | 6e-19 | ||
| 1f34_A | 326 | Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bou | 6e-19 | ||
| 4pep_A | 326 | The Molecular And Crystal Structures Of Monoclinic | 7e-19 | ||
| 3pep_A | 326 | Revised 2.3 Angstroms Structure Of Porcine Pepsin. | 7e-19 | ||
| 3psg_A | 370 | The High Resolution Crystal Structure Of Porcine Pe | 1e-18 | ||
| 2psg_A | 370 | Refined Structure Of Porcine Pepsinogen At 1.8 Angs | 1e-18 | ||
| 1g0v_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 3e-18 | ||
| 5pep_A | 326 | X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dim | 4e-18 | ||
| 3cms_A | 323 | Engineering Enzyme Sub-Site Specificity: Preparatio | 6e-18 | ||
| 1czi_E | 323 | Chymosin Complex With The Inhibitor Cp-113972 Lengt | 6e-18 | ||
| 1dp5_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 7e-18 | ||
| 2jxr_A | 329 | Structure Of Yeast Proteinase A Length = 329 | 8e-18 | ||
| 1htr_B | 329 | Crystal And Molecular Structures Of Human Progastri | 1e-17 | ||
| 1flh_A | 326 | Crystal Structure Of Human Uropepsin At 2.45 A Reso | 1e-17 | ||
| 1pso_E | 326 | The Crystal Structure Of Human Pepsin And Its Compl | 1e-17 | ||
| 1b5f_A | 239 | Native Cardosin A From Cynara Cardunculus L. Length | 2e-17 | ||
| 1am5_A | 324 | The Crystal Structure And Proposed Amino Acid Seque | 2e-15 | ||
| 4aa9_A | 320 | Camel Chymosin At 1.6a Resolution Length = 320 | 4e-15 | ||
| 1lyw_A | 97 | Cathepsin D At Ph 7.5 Length = 97 | 1e-13 | ||
| 1yg9_A | 330 | The Structure Of Mutant (N93q) Of Bla G 2 Length = | 2e-13 | ||
| 3liz_A | 334 | Crystal Structure Of Bla G 2 Complexed With Fab 4c3 | 2e-13 | ||
| 1smr_A | 335 | The 3-D Structure Of Mouse Submaxillary Renin Compl | 5e-13 | ||
| 1smr_A | 335 | The 3-D Structure Of Mouse Submaxillary Renin Compl | 6e-11 | ||
| 3oad_A | 166 | Design And Optimization Of New Piperidines As Renin | 2e-12 | ||
| 2x0b_A | 383 | Crystal Structure Of Human Angiotensinogen Complexe | 2e-12 | ||
| 2x0b_A | 383 | Crystal Structure Of Human Angiotensinogen Complexe | 1e-09 | ||
| 3d91_A | 341 | Human Renin In Complex With Remikiren Length = 341 | 2e-12 | ||
| 3d91_A | 341 | Human Renin In Complex With Remikiren Length = 341 | 9e-10 | ||
| 2bks_A | 340 | Crystal Structure Of Renin-Pf00074777 Complex Lengt | 2e-12 | ||
| 2bks_A | 340 | Crystal Structure Of Renin-Pf00074777 Complex Lengt | 1e-09 | ||
| 3vcm_A | 335 | Crystal Structure Of Human Prorenin Length = 335 | 2e-12 | ||
| 3vcm_A | 335 | Crystal Structure Of Human Prorenin Length = 335 | 1e-09 | ||
| 2i4q_A | 336 | Human ReninPF02342674 COMPLEX Length = 336 | 2e-12 | ||
| 2i4q_A | 336 | Human ReninPF02342674 COMPLEX Length = 336 | 9e-10 | ||
| 1hrn_A | 337 | High Resolution Crystal Structures Of Recombinant H | 2e-12 | ||
| 1hrn_A | 337 | High Resolution Crystal Structures Of Recombinant H | 1e-09 | ||
| 2g24_A | 333 | Ketopiperazine-Based Renin Inhibitors: Optimization | 2e-12 | ||
| 2g24_A | 333 | Ketopiperazine-Based Renin Inhibitors: Optimization | 1e-09 | ||
| 1qdm_A | 478 | Crystal Structure Of Prophytepsin, A Zymogen Of A B | 2e-11 | ||
| 3oad_B | 176 | Design And Optimization Of New Piperidines As Renin | 3e-09 | ||
| 1wkr_A | 340 | Crystal Structure Of Aspartic Proteinase From Irpex | 6e-08 | ||
| 2ewy_A | 383 | Crystal Structure Of Human Bace2 In Complex With A | 5e-06 | ||
| 1uh7_A | 325 | Crystal Structure Of Rhizopuspepsin At Ph 4.6 Lengt | 5e-06 | ||
| 1j71_A | 334 | Structure Of The Extracellular Aspartic Proteinase | 6e-06 | ||
| 3apr_E | 325 | Binding Of A Reduced Peptide Inhibitor To The Aspar | 6e-06 | ||
| 3apr_E | 325 | Binding Of A Reduced Peptide Inhibitor To The Aspar | 6e-06 | ||
| 1ls5_A | 328 | Crystal Structure Of Plasmepsin Iv From P. Falcipar | 6e-06 | ||
| 1ls5_A | 328 | Crystal Structure Of Plasmepsin Iv From P. Falcipar | 8e-06 | ||
| 3qrv_A | 336 | Crystal Structure Of Plasmepsin I (Pmi) From Plasmo | 9e-06 | ||
| 3qrv_A | 336 | Crystal Structure Of Plasmepsin I (Pmi) From Plasmo | 9e-05 | ||
| 2qzx_A | 342 | Secreted Aspartic Proteinase (Sap) 5 From Candida A | 1e-05 | ||
| 2anl_A | 327 | X-Ray Crystal Structure Of The Aspartic Protease Pl | 1e-05 | ||
| 2anl_A | 327 | X-Ray Crystal Structure Of The Aspartic Protease Pl | 1e-04 | ||
| 1miq_A | 375 | Crystal Structure Of Proplasmepsin From The Human M | 2e-05 | ||
| 1miq_A | 375 | Crystal Structure Of Proplasmepsin From The Human M | 5e-05 | ||
| 1qs8_B | 329 | Crystal Structure Of The P. Vivax Aspartic Proteina | 2e-05 | ||
| 1qs8_B | 329 | Crystal Structure Of The P. Vivax Aspartic Proteina | 8e-05 | ||
| 1gvt_A | 329 | Endothiapepsin Complex With Cp-80,794 Length = 329 | 6e-05 | ||
| 1gkt_A | 329 | Neutron Laue Diffraction Structure Of Endothiapepsi | 6e-05 | ||
| 2bju_A | 453 | Plasmepsin Ii Complexed With A Highly Active Achira | 7e-05 | ||
| 3f9q_A | 329 | Re-Refinement Of Uncomplexed Plasmepsin Ii From Pla | 7e-05 | ||
| 1er8_E | 330 | The Active Site Of Aspartic Proteinases Length = 33 | 7e-05 | ||
| 1m43_A | 331 | Crystal Structure Of Pmii In Complex With Pepstatin | 7e-05 | ||
| 1sme_A | 329 | Plasmepsin Ii, A Hemoglobin-Degrading Enzyme From P | 7e-05 | ||
| 1lf3_A | 331 | Crystal Structure Of Plasmepsin Ii From P Falciparu | 8e-05 | ||
| 2rmp_A | 361 | Rmp-Pepstatin A Complex Length = 361 | 8e-05 | ||
| 1pfz_A | 380 | Proplasmepsin Ii From Plasmodium Falciparum Length | 8e-05 | ||
| 1mpp_A | 361 | X-Ray Analyses Of Aspartic Proteinases. V. Structur | 1e-04 | ||
| 1epr_E | 330 | Endothia Aspartic Proteinase (Endothiapepsin) Compl | 1e-04 | ||
| 1ppl_E | 323 | Crystallographic Analysis Of Transition-State Mimic | 1e-04 | ||
| 3fv3_A | 339 | Secreted Aspartic Protease 1 From Candida Parapsilo | 2e-04 | ||
| 3l58_A | 414 | Structure Of Bace Bound To Sch589432 Length = 414 | 3e-04 | ||
| 3vv6_A | 416 | Crystal Structure Of Beta Secetase In Complex With | 3e-04 | ||
| 3dm6_A | 406 | Beta-Secretase 1 Complexed With Statine-Based Inhib | 3e-04 | ||
| 2zjk_A | 405 | Crystal Structure Of The Human Bace1 Catalytic Doma | 3e-04 | ||
| 2zji_A | 405 | Crystal Structure Of The Human Bace1 Catalytic Doma | 3e-04 | ||
| 2zjh_A | 405 | Crystal Structure Of The Human Bace1 Catalytic Doma | 3e-04 | ||
| 3ixk_A | 405 | Potent Beta-Secretase 1 Inhibitor Length = 405 | 3e-04 | ||
| 1tqf_A | 405 | Crystal Structure Of Human Beta Secretase Complexed | 4e-04 | ||
| 3exo_A | 413 | Crystal Structure Of Bace1 Bound To Inhibitor Lengt | 4e-04 | ||
| 2zjn_A | 405 | Crystal Structure Of The Human Bace1 Catalytic Doma | 4e-04 | ||
| 2of0_A | 402 | X-Ray Crystal Structure Of Beta Secretase Complexed | 4e-04 | ||
| 2hm1_A | 406 | Crystal Structure Of Human Beta-Secretase (Bace) In | 4e-04 | ||
| 2fdp_A | 388 | Crystal Structure Of Beta-Secretase Complexed With | 4e-04 | ||
| 3qi1_A | 408 | Design And Synthesis Of Hydroxyethylamine (Hea) Bac | 4e-04 | ||
| 3kmx_A | 395 | Structure Of Bace Bound To Sch346572 Length = 395 | 4e-04 | ||
| 1fkn_A | 391 | Structure Of Beta-Secretase Complexed With Inhibito | 4e-04 | ||
| 3ckp_A | 412 | Crystal Structure Of Bace-1 In Complex With Inhibit | 4e-04 | ||
| 2zhr_A | 411 | Crystal Structure Of Bace1 In Complex With Om99-2 A | 4e-04 | ||
| 1w50_A | 411 | Apo Structure Of Bace (beta Secretase) Length = 411 | 4e-04 | ||
| 4dpf_A | 391 | Bace-1 In Complex With A Hea-Macrocyclic Type Inhib | 4e-04 | ||
| 1ym2_A | 402 | Crystal Structure Of Human Beta Secretase Complexed | 4e-04 | ||
| 3tpj_A | 433 | Apo Structure Of Bace1 Length = 433 | 4e-04 | ||
| 2wjo_A | 412 | Human Bace (Beta Secretase) In Complex With Cyclohe | 4e-04 | ||
| 3hvg_A | 411 | Structure Of Bace (Beta Secretase) In Complex With | 4e-04 | ||
| 2qk5_A | 395 | Structure Of Bace1 Bound To Sch626485 Length = 395 | 4e-04 | ||
| 4ewo_A | 386 | Design And Synthesis Of Potent Hydroxyethylamine (H | 4e-04 | ||
| 4b1d_A | 388 | New Aminoimidazoles As Bace-1 Inhibitors: From Rati | 4e-04 | ||
| 2qu2_A | 415 | Bace1 With Compound 1 Length = 415 | 4e-04 | ||
| 3udh_A | 404 | Crystal Structure Of Bace With Compound 1 Length = | 4e-04 | ||
| 3tpr_A | 433 | Crystal Structure Of Bace1 Complexed With An Inhibi | 4e-04 | ||
| 2vie_A | 392 | Human Bace-1 In Complex With N-((1s,2r)-1-Benzyl-2- | 4e-04 | ||
| 2q15_A | 385 | Structure Of Bace Complexed To Compound 3a Length = | 4e-04 | ||
| 1sgz_A | 389 | Crystal Structure Of Unbound Beta-Secretase Catalyt | 4e-04 | ||
| 2qzl_A | 411 | Crystal Structure Of Human Beta Secretase Complexed | 4e-04 | ||
| 3u6a_A | 390 | Rational Design And Synthesis Of Aminopiperazinones | 4e-04 | ||
| 3r1g_B | 402 | Structure Basis Of Allosteric Inhibition Of Bace1 B | 4e-04 | ||
| 1ym4_A | 408 | Crystal Structure Of Human Beta Secretase Complexed | 4e-04 | ||
| 3cib_A | 390 | Structure Of Bace Bound To Sch727596 Length = 390 | 4e-04 | ||
| 2q11_A | 388 | Structure Of Bace Complexed To Compound 1 Length = | 4e-04 | ||
| 3lpi_A | 455 | Structure Of Bace Bound To Sch745132 Length = 455 | 4e-04 | ||
| 2hiz_A | 455 | Crystal Structure Of Human Beta-Secretase (Bace) In | 4e-04 | ||
| 2va5_A | 455 | X-Ray Crystal Structure Of Beta Secretase Complexed | 4e-04 | ||
| 1zap_A | 342 | Secreted Aspartic Protease From C. Albicans Length | 6e-04 | ||
| 1eag_A | 342 | Secreted Aspartic Proteinase (Sap2) From Candida Al | 6e-04 |
| >pdb|1TZS|A Chain A, Crystal Structure Of An Activation Intermediate Of Cathepsin E Length = 351 | Back alignment and structure |
|
| >pdb|1LYA|B Chain B, Crystal Structures Of Native And Inhibited Forms Of Human Cathepsin D: Implications For Lysosomal Targeting And Drug Design Length = 241 | Back alignment and structure |
| >pdb|1PSA|A Chain A, Structure Of A Pepsin(Slash)renin Inhibitor Complex Reveals A Novel Crystal Packing Induced By Minor Chemical Alterations In The Inhibitor Length = 326 | Back alignment and structure |
| >pdb|1F34|A Chain A, Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bound To Porcine Pepsin Length = 326 | Back alignment and structure |
| >pdb|4PEP|A Chain A, The Molecular And Crystal Structures Of Monoclinic Porcine Pepsin Refined At 1.8 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|3PEP|A Chain A, Revised 2.3 Angstroms Structure Of Porcine Pepsin. Evidence For A Flexible Subdomain Length = 326 | Back alignment and structure |
| >pdb|3PSG|A Chain A, The High Resolution Crystal Structure Of Porcine Pepsinogen Length = 370 | Back alignment and structure |
| >pdb|2PSG|A Chain A, Refined Structure Of Porcine Pepsinogen At 1.8 Angstroms Resolution Length = 370 | Back alignment and structure |
| >pdb|1G0V|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant, Mvv Length = 329 | Back alignment and structure |
| >pdb|5PEP|A Chain A, X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dimensional Structure Of The Hexagonal Crystal Form Of Porcine Pepsin At 2.3 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|3CMS|A Chain A, Engineering Enzyme Sub-Site Specificity: Preparation, Kinetic Characterization And X-Ray Analysis At 2.0-Angstroms Resolution Of Val111phe Site-Mutated Calf Chymosin Length = 323 | Back alignment and structure |
| >pdb|1CZI|E Chain E, Chymosin Complex With The Inhibitor Cp-113972 Length = 323 | Back alignment and structure |
| >pdb|1DP5|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant Inhibitor Length = 329 | Back alignment and structure |
| >pdb|2JXR|A Chain A, Structure Of Yeast Proteinase A Length = 329 | Back alignment and structure |
| >pdb|1HTR|B Chain B, Crystal And Molecular Structures Of Human Progastricsin At 1.62 Angstroms Resolution Length = 329 | Back alignment and structure |
| >pdb|1FLH|A Chain A, Crystal Structure Of Human Uropepsin At 2.45 A Resolution Length = 326 | Back alignment and structure |
| >pdb|1PSO|E Chain E, The Crystal Structure Of Human Pepsin And Its Complex With Pepstatin Length = 326 | Back alignment and structure |
| >pdb|1B5F|A Chain A, Native Cardosin A From Cynara Cardunculus L. Length = 239 | Back alignment and structure |
| >pdb|1AM5|A Chain A, The Crystal Structure And Proposed Amino Acid Sequence Of A Pepsin From Atlantic Cod (Gadus Morhua) Length = 324 | Back alignment and structure |
| >pdb|4AA9|A Chain A, Camel Chymosin At 1.6a Resolution Length = 320 | Back alignment and structure |
| >pdb|1LYW|A Chain A, Cathepsin D At Ph 7.5 Length = 97 | Back alignment and structure |
| >pdb|1YG9|A Chain A, The Structure Of Mutant (N93q) Of Bla G 2 Length = 330 | Back alignment and structure |
| >pdb|3LIZ|A Chain A, Crystal Structure Of Bla G 2 Complexed With Fab 4c3 Length = 334 | Back alignment and structure |
| >pdb|1SMR|A Chain A, The 3-D Structure Of Mouse Submaxillary Renin Complexed With A Decapeptide Inhibitor Ch-66 Based On The 4-16 Fragment Of Rat Angiotensinogen Length = 335 | Back alignment and structure |
| >pdb|1SMR|A Chain A, The 3-D Structure Of Mouse Submaxillary Renin Complexed With A Decapeptide Inhibitor Ch-66 Based On The 4-16 Fragment Of Rat Angiotensinogen Length = 335 | Back alignment and structure |
| >pdb|3OAD|A Chain A, Design And Optimization Of New Piperidines As Renin Inhibitors Length = 166 | Back alignment and structure |
| >pdb|2X0B|A Chain A, Crystal Structure Of Human Angiotensinogen Complexed With Renin Length = 383 | Back alignment and structure |
| >pdb|2X0B|A Chain A, Crystal Structure Of Human Angiotensinogen Complexed With Renin Length = 383 | Back alignment and structure |
| >pdb|3D91|A Chain A, Human Renin In Complex With Remikiren Length = 341 | Back alignment and structure |
| >pdb|3D91|A Chain A, Human Renin In Complex With Remikiren Length = 341 | Back alignment and structure |
| >pdb|2BKS|A Chain A, Crystal Structure Of Renin-Pf00074777 Complex Length = 340 | Back alignment and structure |
| >pdb|2BKS|A Chain A, Crystal Structure Of Renin-Pf00074777 Complex Length = 340 | Back alignment and structure |
| >pdb|3VCM|A Chain A, Crystal Structure Of Human Prorenin Length = 335 | Back alignment and structure |
| >pdb|3VCM|A Chain A, Crystal Structure Of Human Prorenin Length = 335 | Back alignment and structure |
| >pdb|2I4Q|A Chain A, Human ReninPF02342674 COMPLEX Length = 336 | Back alignment and structure |
| >pdb|2I4Q|A Chain A, Human ReninPF02342674 COMPLEX Length = 336 | Back alignment and structure |
| >pdb|1HRN|A Chain A, High Resolution Crystal Structures Of Recombinant Human Renin In Complex With Polyhydroxymonoamide Inhibitors Length = 337 | Back alignment and structure |
| >pdb|1HRN|A Chain A, High Resolution Crystal Structures Of Recombinant Human Renin In Complex With Polyhydroxymonoamide Inhibitors Length = 337 | Back alignment and structure |
| >pdb|2G24|A Chain A, Ketopiperazine-Based Renin Inhibitors: Optimization Of The "c" Ring Length = 333 | Back alignment and structure |
| >pdb|2G24|A Chain A, Ketopiperazine-Based Renin Inhibitors: Optimization Of The "c" Ring Length = 333 | Back alignment and structure |
| >pdb|1QDM|A Chain A, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley Vacuolar Aspartic Proteinase. Length = 478 | Back alignment and structure |
| >pdb|3OAD|B Chain B, Design And Optimization Of New Piperidines As Renin Inhibitors Length = 176 | Back alignment and structure |
| >pdb|1WKR|A Chain A, Crystal Structure Of Aspartic Proteinase From Irpex Lacteus Length = 340 | Back alignment and structure |
| >pdb|2EWY|A Chain A, Crystal Structure Of Human Bace2 In Complex With A Hydroxyethylenamine Transition-State Inhibitor Length = 383 | Back alignment and structure |
| >pdb|1UH7|A Chain A, Crystal Structure Of Rhizopuspepsin At Ph 4.6 Length = 325 | Back alignment and structure |
| >pdb|1J71|A Chain A, Structure Of The Extracellular Aspartic Proteinase From Candida Tropicalis Yeast Length = 334 | Back alignment and structure |
| >pdb|3APR|E Chain E, Binding Of A Reduced Peptide Inhibitor To The Aspartic Proteinase From Rhizopus Chinensis. Implications For A Mechanism Of Action Length = 325 | Back alignment and structure |
| >pdb|3APR|E Chain E, Binding Of A Reduced Peptide Inhibitor To The Aspartic Proteinase From Rhizopus Chinensis. Implications For A Mechanism Of Action Length = 325 | Back alignment and structure |
| >pdb|1LS5|A Chain A, Crystal Structure Of Plasmepsin Iv From P. Falciparum In Complex With Pepstatin A Length = 328 | Back alignment and structure |
| >pdb|1LS5|A Chain A, Crystal Structure Of Plasmepsin Iv From P. Falciparum In Complex With Pepstatin A Length = 328 | Back alignment and structure |
| >pdb|3QRV|A Chain A, Crystal Structure Of Plasmepsin I (Pmi) From Plasmodium Falciparum Length = 336 | Back alignment and structure |
| >pdb|3QRV|A Chain A, Crystal Structure Of Plasmepsin I (Pmi) From Plasmodium Falciparum Length = 336 | Back alignment and structure |
| >pdb|2QZX|A Chain A, Secreted Aspartic Proteinase (Sap) 5 From Candida Albicans Length = 342 | Back alignment and structure |
| >pdb|2ANL|A Chain A, X-Ray Crystal Structure Of The Aspartic Protease Plasmepsin 4 From The Malarial Parasite Plasmodium Malariae Bound To An Allophenylnorstatine Based Inhibitor Length = 327 | Back alignment and structure |
| >pdb|2ANL|A Chain A, X-Ray Crystal Structure Of The Aspartic Protease Plasmepsin 4 From The Malarial Parasite Plasmodium Malariae Bound To An Allophenylnorstatine Based Inhibitor Length = 327 | Back alignment and structure |
| >pdb|1MIQ|A Chain A, Crystal Structure Of Proplasmepsin From The Human Malarial Pathogen Plasmodium Vivax Length = 375 | Back alignment and structure |
| >pdb|1MIQ|A Chain A, Crystal Structure Of Proplasmepsin From The Human Malarial Pathogen Plasmodium Vivax Length = 375 | Back alignment and structure |
| >pdb|1GVT|A Chain A, Endothiapepsin Complex With Cp-80,794 Length = 329 | Back alignment and structure |
| >pdb|1GKT|A Chain A, Neutron Laue Diffraction Structure Of Endothiapepsin Complexed With Transition State Analogue Inhibitor H261 Length = 329 | Back alignment and structure |
| >pdb|2BJU|A Chain A, Plasmepsin Ii Complexed With A Highly Active Achiral Inhibitor Length = 453 | Back alignment and structure |
| >pdb|3F9Q|A Chain A, Re-Refinement Of Uncomplexed Plasmepsin Ii From Plasmodium Falciparum Length = 329 | Back alignment and structure |
| >pdb|1ER8|E Chain E, The Active Site Of Aspartic Proteinases Length = 330 | Back alignment and structure |
| >pdb|1M43|A Chain A, Crystal Structure Of Pmii In Complex With Pepstatin A To 2.4 A Length = 331 | Back alignment and structure |
| >pdb|1SME|A Chain A, Plasmepsin Ii, A Hemoglobin-Degrading Enzyme From Plasmodium Falciparum, In Complex With Pepstatin A Length = 329 | Back alignment and structure |
| >pdb|1LF3|A Chain A, Crystal Structure Of Plasmepsin Ii From P Falciparum In Complex With Inhibitor Eh58 Length = 331 | Back alignment and structure |
| >pdb|2RMP|A Chain A, Rmp-Pepstatin A Complex Length = 361 | Back alignment and structure |
| >pdb|1PFZ|A Chain A, Proplasmepsin Ii From Plasmodium Falciparum Length = 380 | Back alignment and structure |
| >pdb|1MPP|A Chain A, X-Ray Analyses Of Aspartic Proteinases. V. Structure And Refinement At 2.0 Angstroms Resolution Of The Aspartic Proteinase From Mucor Pusillus Length = 361 | Back alignment and structure |
| >pdb|1EPR|E Chain E, Endothia Aspartic Proteinase (Endothiapepsin) Complexed With Pd-135, 040 Length = 330 | Back alignment and structure |
| >pdb|1PPL|E Chain E, Crystallographic Analysis Of Transition-State Mimics Bound To Penicillopepsin: Phosphorus-Containing Peptide Analogues Length = 323 | Back alignment and structure |
| >pdb|3FV3|A Chain A, Secreted Aspartic Protease 1 From Candida Parapsilosis In Complex With Pepstatin A Length = 339 | Back alignment and structure |
| >pdb|3L58|A Chain A, Structure Of Bace Bound To Sch589432 Length = 414 | Back alignment and structure |
| >pdb|3VV6|A Chain A, Crystal Structure Of Beta Secetase In Complex With 2-Amino-3-Methyl-6- ((1s, 2r)-2-Phenylcyclopropyl)pyrimidin-4(3h)-One Length = 416 | Back alignment and structure |
| >pdb|3DM6|A Chain A, Beta-Secretase 1 Complexed With Statine-Based Inhibitor Length = 406 | Back alignment and structure |
| >pdb|2ZJK|A Chain A, Crystal Structure Of The Human Bace1 Catalytic Domain In Complex With 4-(4-Fluoro-Benzyl)-Piperazine-2-Carboxylic Acid(3-Mercapto-Propyl)-Amide Length = 405 | Back alignment and structure |
| >pdb|2ZJI|A Chain A, Crystal Structure Of The Human Bace1 Catalytic Domain In Complex With N-[1-(2, 6-Dimethoxy-Benzyl)-Piperidin-4-Yl]-4-Mercapto- Butyramide Length = 405 | Back alignment and structure |
| >pdb|2ZJH|A Chain A, Crystal Structure Of The Human Bace1 Catalytic Domain In Complex With N-(1-Benzyl-Piperidin-4-Yl)-4-Mercapto-Butyramide Length = 405 | Back alignment and structure |
| >pdb|3IXK|A Chain A, Potent Beta-Secretase 1 Inhibitor Length = 405 | Back alignment and structure |
| >pdb|1TQF|A Chain A, Crystal Structure Of Human Beta Secretase Complexed With Inhibitor Length = 405 | Back alignment and structure |
| >pdb|3EXO|A Chain A, Crystal Structure Of Bace1 Bound To Inhibitor Length = 413 | Back alignment and structure |
| >pdb|2ZJN|A Chain A, Crystal Structure Of The Human Bace1 Catalytic Domain In Complex With N-[1-(5-Chloro-2-Isopropoxy-3-Methoxy-Benzyl)- Piperidin-4-Yl]-2-(2-Methyl-4-Sulfamoyl-Phenoxy)- Acetamide Length = 405 | Back alignment and structure |
| >pdb|2OF0|A Chain A, X-Ray Crystal Structure Of Beta Secretase Complexed With Compound 5 Length = 402 | Back alignment and structure |
| >pdb|2HM1|A Chain A, Crystal Structure Of Human Beta-Secretase (Bace) In The Presence Of An Inhibitor (2) Length = 406 | Back alignment and structure |
| >pdb|2FDP|A Chain A, Crystal Structure Of Beta-Secretase Complexed With An Amino- Ethylene Inhibitor Length = 388 | Back alignment and structure |
| >pdb|3QI1|A Chain A, Design And Synthesis Of Hydroxyethylamine (Hea) Bace-1 Inhibitors: Prime Side Chromane-Containing Inhibitors Length = 408 | Back alignment and structure |
| >pdb|3KMX|A Chain A, Structure Of Bace Bound To Sch346572 Length = 395 | Back alignment and structure |
| >pdb|1FKN|A Chain A, Structure Of Beta-Secretase Complexed With Inhibitor Length = 391 | Back alignment and structure |
| >pdb|3CKP|A Chain A, Crystal Structure Of Bace-1 In Complex With Inhibitor Length = 412 | Back alignment and structure |
| >pdb|2ZHR|A Chain A, Crystal Structure Of Bace1 In Complex With Om99-2 At Ph 5.0 Length = 411 | Back alignment and structure |
| >pdb|1W50|A Chain A, Apo Structure Of Bace (beta Secretase) Length = 411 | Back alignment and structure |
| >pdb|4DPF|A Chain A, Bace-1 In Complex With A Hea-Macrocyclic Type Inhibitor Length = 391 | Back alignment and structure |
| >pdb|1YM2|A Chain A, Crystal Structure Of Human Beta Secretase Complexed With Nvp-Aur200 Length = 402 | Back alignment and structure |
| >pdb|3TPJ|A Chain A, Apo Structure Of Bace1 Length = 433 | Back alignment and structure |
| >pdb|2WJO|A Chain A, Human Bace (Beta Secretase) In Complex With Cyclohexanecarboxylic Acid (2-(2-Am Ino-6-Phenoxy-4h- Quinazolin-3-Yl)-2-Cyclohexyl-Ethyl)-Amide Length = 412 | Back alignment and structure |
| >pdb|3HVG|A Chain A, Structure Of Bace (Beta Secretase) In Complex With Ev0 Length = 411 | Back alignment and structure |
| >pdb|2QK5|A Chain A, Structure Of Bace1 Bound To Sch626485 Length = 395 | Back alignment and structure |
| >pdb|4EWO|A Chain A, Design And Synthesis Of Potent Hydroxyethylamine (Hea) Bace-1 Inhibitors Length = 386 | Back alignment and structure |
| >pdb|4B1D|A Chain A, New Aminoimidazoles As Bace-1 Inhibitors: From Rational Design To Ab-Lowering In Brain Length = 388 | Back alignment and structure |
| >pdb|2QU2|A Chain A, Bace1 With Compound 1 Length = 415 | Back alignment and structure |
| >pdb|3UDH|A Chain A, Crystal Structure Of Bace With Compound 1 Length = 404 | Back alignment and structure |
| >pdb|3TPR|A Chain A, Crystal Structure Of Bace1 Complexed With An Inhibitor Length = 433 | Back alignment and structure |
| >pdb|2VIE|A Chain A, Human Bace-1 In Complex With N-((1s,2r)-1-Benzyl-2-Hydroxy- 3-((1,1, 5-Trimethylhexyl)amino)propyl)-3-(Ethylamino)-5-(2- Oxopyrrolidin-1-Yl)benzamide Length = 392 | Back alignment and structure |
| >pdb|2Q15|A Chain A, Structure Of Bace Complexed To Compound 3a Length = 385 | Back alignment and structure |
| >pdb|1SGZ|A Chain A, Crystal Structure Of Unbound Beta-Secretase Catalytic Domain. Length = 389 | Back alignment and structure |
| >pdb|2QZL|A Chain A, Crystal Structure Of Human Beta Secretase Complexed With Ixs Length = 411 | Back alignment and structure |
| >pdb|3U6A|A Chain A, Rational Design And Synthesis Of Aminopiperazinones As Beta Secretase (Bace) Inhibitors Length = 390 | Back alignment and structure |
| >pdb|3R1G|B Chain B, Structure Basis Of Allosteric Inhibition Of Bace1 By An Exosite- Binding Antibody Length = 402 | Back alignment and structure |
| >pdb|1YM4|A Chain A, Crystal Structure Of Human Beta Secretase Complexed With Nvp-Amk640 Length = 408 | Back alignment and structure |
| >pdb|3CIB|A Chain A, Structure Of Bace Bound To Sch727596 Length = 390 | Back alignment and structure |
| >pdb|2Q11|A Chain A, Structure Of Bace Complexed To Compound 1 Length = 388 | Back alignment and structure |
| >pdb|3LPI|A Chain A, Structure Of Bace Bound To Sch745132 Length = 455 | Back alignment and structure |
| >pdb|2HIZ|A Chain A, Crystal Structure Of Human Beta-Secretase (Bace) In The Presence Of An Inhibitor Length = 455 | Back alignment and structure |
| >pdb|2VA5|A Chain A, X-Ray Crystal Structure Of Beta Secretase Complexed With Compound 8c Length = 455 | Back alignment and structure |
| >pdb|1ZAP|A Chain A, Secreted Aspartic Protease From C. Albicans Length = 342 | Back alignment and structure |
| >pdb|1EAG|A Chain A, Secreted Aspartic Proteinase (Sap2) From Candida Albicans Complexed With A70450 Length = 342 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 177 | |||
| 1lya_B | 241 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 3e-48 | |
| 1dpj_A | 329 | Proteinase A; proteinase A, hydrolase-hydrolase in | 8e-46 | |
| 1dpj_A | 329 | Proteinase A; proteinase A, hydrolase-hydrolase in | 4e-21 | |
| 1htr_B | 329 | Gastricsin; aspartyl protease; 1.62A {Homo sapiens | 5e-45 | |
| 1htr_B | 329 | Gastricsin; aspartyl protease; 1.62A {Homo sapiens | 3e-21 | |
| 1yg9_A | 330 | Aspartic protease BLA G 2; allegren, hydrolase, al | 8e-45 | |
| 1yg9_A | 330 | Aspartic protease BLA G 2; allegren, hydrolase, al | 2e-18 | |
| 1am5_A | 324 | Pepsin, acid proteinase; aspartyl protease, hydrol | 4e-44 | |
| 1am5_A | 324 | Pepsin, acid proteinase; aspartyl protease, hydrol | 3e-21 | |
| 3cms_A | 323 | Chymosin B; hydrolase, acid proteinase; 2.00A {Bos | 5e-44 | |
| 3cms_A | 323 | Chymosin B; hydrolase, acid proteinase; 2.00A {Bos | 2e-21 | |
| 3psg_A | 370 | Pepsinogen; hydrolase(acid proteinase zymogen); 1. | 1e-43 | |
| 3psg_A | 370 | Pepsinogen; hydrolase(acid proteinase zymogen); 1. | 3e-18 | |
| 1tzs_A | 351 | Cathepsin E; hydrolase, aspartic protease, activat | 5e-43 | |
| 1tzs_A | 351 | Cathepsin E; hydrolase, aspartic protease, activat | 3e-21 | |
| 2bju_A | 453 | Plasmepsin II; aspartic proteinase, drug design, m | 1e-42 | |
| 2bju_A | 453 | Plasmepsin II; aspartic proteinase, drug design, m | 3e-21 | |
| 2x0b_A | 383 | Renin; hydrolase-hormone complex, hydrolase hormon | 3e-42 | |
| 2x0b_A | 383 | Renin; hydrolase-hormone complex, hydrolase hormon | 1e-21 | |
| 1miq_A | 375 | Plasmepsin; aspartic proteinase zymogen, domain op | 3e-42 | |
| 1miq_A | 375 | Plasmepsin; aspartic proteinase zymogen, domain op | 2e-21 | |
| 2apr_A | 325 | Rhizopuspepsin; hydrolase (aspartic proteinase); 1 | 6e-42 | |
| 2apr_A | 325 | Rhizopuspepsin; hydrolase (aspartic proteinase); 1 | 7e-20 | |
| 3k1w_A | 341 | Renin; protease, alternative splicing, aspartyl pr | 6e-42 | |
| 3k1w_A | 341 | Renin; protease, alternative splicing, aspartyl pr | 7e-23 | |
| 3fv3_A | 339 | SAPP1P-secreted aspartic protease 1; secreted aspa | 1e-40 | |
| 3fv3_A | 339 | SAPP1P-secreted aspartic protease 1; secreted aspa | 2e-17 | |
| 3c9x_A | 329 | Trichoderma reesei aspartic protease; aspartic pro | 1e-40 | |
| 3c9x_A | 329 | Trichoderma reesei aspartic protease; aspartic pro | 1e-19 | |
| 3qvc_A | 451 | Histo-aspartic protease; HAP, plasmepsin, zymogen, | 3e-40 | |
| 3qvc_A | 451 | Histo-aspartic protease; HAP, plasmepsin, zymogen, | 3e-21 | |
| 1wkr_A | 340 | Polyporopepsin; hydrolase, hydrolase-hydrolase inh | 3e-40 | |
| 1wkr_A | 340 | Polyporopepsin; hydrolase, hydrolase-hydrolase inh | 7e-20 | |
| 1izd_A | 323 | Aspartic proteinase; sugar binding, acid protease, | 8e-40 | |
| 1izd_A | 323 | Aspartic proteinase; sugar binding, acid protease, | 4e-15 | |
| 1j71_A | 334 | Candidapepsin, aspartic proteinase; candida tropic | 5e-38 | |
| 1j71_A | 334 | Candidapepsin, aspartic proteinase; candida tropic | 1e-17 | |
| 1oew_A | 329 | Endothiapepsin; hydrolase, aspartic proteinase mec | 9e-38 | |
| 1oew_A | 329 | Endothiapepsin; hydrolase, aspartic proteinase mec | 1e-18 | |
| 2qzx_A | 342 | Candidapepsin-5; aspartic proteinase, aspartyl pro | 2e-37 | |
| 2qzx_A | 342 | Candidapepsin-5; aspartic proteinase, aspartyl pro | 7e-16 | |
| 1ibq_A | 325 | Aspergillopepsin; aspartic proteinase, hydrolase; | 2e-36 | |
| 1ibq_A | 325 | Aspergillopepsin; aspartic proteinase, hydrolase; | 6e-15 | |
| 2ewy_A | 383 | Beta-secretase 2; BACE2, aspartic protease, hydrol | 3e-36 | |
| 2ewy_A | 383 | Beta-secretase 2; BACE2, aspartic protease, hydrol | 3e-19 | |
| 3pvk_A | 342 | Candidapepsin-2; hydrolase; 1.27A {Candida albican | 6e-36 | |
| 3pvk_A | 342 | Candidapepsin-2; hydrolase; 1.27A {Candida albican | 2e-17 | |
| 1bxo_A | 323 | Protein (penicillopepsin); hydrolase, phosphonate | 9e-36 | |
| 1bxo_A | 323 | Protein (penicillopepsin); hydrolase, phosphonate | 8e-15 | |
| 1b5f_A | 239 | Protein (cardosin A); hydrolase, aspartic proteina | 3e-35 | |
| 1b5f_A | 239 | Protein (cardosin A); hydrolase, aspartic proteina | 5e-22 | |
| 3lpj_A | 455 | Beta-secretase 1; alzheimer'S, aspartyl protease, | 2e-34 | |
| 3lpj_A | 455 | Beta-secretase 1; alzheimer'S, aspartyl protease, | 5e-19 | |
| 2qp8_A | 395 | Beta-secretase 1; BACE1, protease, alternative spl | 5e-34 | |
| 2qp8_A | 395 | Beta-secretase 1; BACE1, protease, alternative spl | 7e-19 | |
| 1mpp_A | 361 | Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu | 3e-33 | |
| 1mpp_A | 361 | Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu | 8e-20 | |
| 1qdm_A | 478 | Prophytepsin; aspartic proteinases, saposin-like d | 3e-30 | |
| 1qdm_A | 478 | Prophytepsin; aspartic proteinases, saposin-like d | 4e-28 | |
| 1qdm_A | 478 | Prophytepsin; aspartic proteinases, saposin-like d | 1e-21 | |
| 1lya_A | 97 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 2e-20 | |
| 3aup_A | 403 | SBG7S, BG, basic 7S globulin; pepsin-like fold, pl | 1e-09 | |
| 3vla_A | 413 | EDGP; extracellular, inhibitor, plant protein; HET | 3e-07 | |
| 1b5f_B | 87 | Protein (cardosin A); hydrolase, aspartic proteina | 1e-04 | |
| 1t6e_X | 381 | Xylanase inhibitor; two beta-barrel domain structu | 8e-04 |
| >1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* Length = 241 | Back alignment and structure |
|---|
Score = 155 bits (395), Expect = 3e-48
Identities = 44/116 (37%), Positives = 69/116 (59%), Gaps = 2/116 (1%)
Query: 61 RNASDENGGEIMFGGVDKDKFVGDITYSPVSRKGYWQFGVESIKIEKNVYC--SNCQAIA 118
R+ + GGE+M GG D + G ++Y V+RK YWQ ++ +++ + C+AI
Sbjct: 66 RDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIV 125
Query: 119 DTGTSLIIGPSKVIAELNKLIGAVPLANGPAKVDCDNLDKMPNVDIILGGKNFTLT 174
DTGTSL++GP + EL K IGAVPL G + C+ + +P + + LGGK + L+
Sbjct: 126 DTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLS 181
|
| >1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Length = 329 | Back alignment and structure |
|---|
| >1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Length = 329 | Back alignment and structure |
|---|
| >1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Length = 329 | Back alignment and structure |
|---|
| >1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Length = 329 | Back alignment and structure |
|---|
| >1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Length = 330 | Back alignment and structure |
|---|
| >1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Length = 330 | Back alignment and structure |
|---|
| >1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Length = 324 | Back alignment and structure |
|---|
| >1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Length = 324 | Back alignment and structure |
|---|
| >3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Length = 323 | Back alignment and structure |
|---|
| >3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Length = 323 | Back alignment and structure |
|---|
| >3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Length = 370 | Back alignment and structure |
|---|
| >3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Length = 370 | Back alignment and structure |
|---|
| >1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Length = 351 | Back alignment and structure |
|---|
| >1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Length = 351 | Back alignment and structure |
|---|
| >2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Length = 453 | Back alignment and structure |
|---|
| >2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Length = 453 | Back alignment and structure |
|---|
| >2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Length = 375 | Back alignment and structure |
|---|
| >1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Length = 375 | Back alignment and structure |
|---|
| >2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Length = 325 | Back alignment and structure |
|---|
| >2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Length = 325 | Back alignment and structure |
|---|
| >3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Length = 341 | Back alignment and structure |
|---|
| >3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Length = 341 | Back alignment and structure |
|---|
| >3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} PDB: 3tne_A* Length = 339 | Back alignment and structure |
|---|
| >3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} PDB: 3tne_A* Length = 339 | Back alignment and structure |
|---|
| >3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Length = 329 | Back alignment and structure |
|---|
| >3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Length = 329 | Back alignment and structure |
|---|
| >3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Length = 451 | Back alignment and structure |
|---|
| >3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Length = 451 | Back alignment and structure |
|---|
| >1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Length = 340 | Back alignment and structure |
|---|
| >1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Length = 340 | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Length = 323 | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Length = 323 | Back alignment and structure |
|---|
| >1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Length = 334 | Back alignment and structure |
|---|
| >1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Length = 334 | Back alignment and structure |
|---|
| >1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Length = 329 | Back alignment and structure |
|---|
| >1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Length = 329 | Back alignment and structure |
|---|
| >2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Length = 342 | Back alignment and structure |
|---|
| >2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Length = 342 | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Length = 325 | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Length = 325 | Back alignment and structure |
|---|
| >2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Length = 342 | Back alignment and structure |
|---|
| >3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Length = 342 | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Length = 323 | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Length = 323 | Back alignment and structure |
|---|
| >1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Length = 239 | Back alignment and structure |
|---|
| >1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Length = 239 | Back alignment and structure |
|---|
| >3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Length = 455 | Back alignment and structure |
|---|
| >3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Length = 455 | Back alignment and structure |
|---|
| >2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Length = 395 | Back alignment and structure |
|---|
| >2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Length = 395 | Back alignment and structure |
|---|
| >1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Length = 361 | Back alignment and structure |
|---|
| >1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Length = 361 | Back alignment and structure |
|---|
| >1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 Length = 478 | Back alignment and structure |
|---|
| >1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 Length = 478 | Back alignment and structure |
|---|
| >1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 Length = 478 | Back alignment and structure |
|---|
| >1lya_A Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_A* 1lyw_A* Length = 97 | Back alignment and structure |
|---|
| >3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Length = 403 | Back alignment and structure |
|---|
| >3vla_A EDGP; extracellular, inhibitor, plant protein; HET: NAG; 0.95A {Daucus carota} PDB: 3vlb_A Length = 413 | Back alignment and structure |
|---|
| >1b5f_B Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Length = 87 | Back alignment and structure |
|---|
| >1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A Length = 381 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 177 | |||
| 3psg_A | 370 | Pepsinogen; hydrolase(acid proteinase zymogen); 1. | 100.0 | |
| 2x0b_A | 383 | Renin; hydrolase-hormone complex, hydrolase hormon | 100.0 | |
| 4aa9_A | 320 | Chymosin; hydrolase, aspartic peptidase, rennet; H | 100.0 | |
| 3cms_A | 323 | Chymosin B; hydrolase, acid proteinase; 2.00A {Bos | 100.0 | |
| 1dpj_A | 329 | Proteinase A; proteinase A, hydrolase-hydrolase in | 100.0 | |
| 1tzs_A | 351 | Cathepsin E; hydrolase, aspartic protease, activat | 100.0 | |
| 3k1w_A | 341 | Renin; protease, alternative splicing, aspartyl pr | 100.0 | |
| 1am5_A | 324 | Pepsin, acid proteinase; aspartyl protease, hydrol | 100.0 | |
| 1htr_B | 329 | Gastricsin; aspartyl protease; 1.62A {Homo sapiens | 100.0 | |
| 3qvc_A | 451 | Histo-aspartic protease; HAP, plasmepsin, zymogen, | 100.0 | |
| 1qdm_A | 478 | Prophytepsin; aspartic proteinases, saposin-like d | 100.0 | |
| 1miq_A | 375 | Plasmepsin; aspartic proteinase zymogen, domain op | 100.0 | |
| 3c9x_A | 329 | Trichoderma reesei aspartic protease; aspartic pro | 100.0 | |
| 2bju_A | 453 | Plasmepsin II; aspartic proteinase, drug design, m | 100.0 | |
| 1oew_A | 329 | Endothiapepsin; hydrolase, aspartic proteinase mec | 100.0 | |
| 2apr_A | 325 | Rhizopuspepsin; hydrolase (aspartic proteinase); 1 | 100.0 | |
| 1mpp_A | 361 | Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu | 100.0 | |
| 1j71_A | 334 | Candidapepsin, aspartic proteinase; candida tropic | 100.0 | |
| 1yg9_A | 330 | Aspartic protease BLA G 2; allegren, hydrolase, al | 100.0 | |
| 2qzx_A | 342 | Candidapepsin-5; aspartic proteinase, aspartyl pro | 100.0 | |
| 3pvk_A | 342 | Candidapepsin-2; hydrolase; 1.27A {Candida albican | 100.0 | |
| 3fv3_A | 339 | SAPP1P-secreted aspartic protease 1; secreted aspa | 100.0 | |
| 1izd_A | 323 | Aspartic proteinase; sugar binding, acid protease, | 100.0 | |
| 1ibq_A | 325 | Aspergillopepsin; aspartic proteinase, hydrolase; | 100.0 | |
| 1bxo_A | 323 | Protein (penicillopepsin); hydrolase, phosphonate | 100.0 | |
| 1wkr_A | 340 | Polyporopepsin; hydrolase, hydrolase-hydrolase inh | 100.0 | |
| 2ewy_A | 383 | Beta-secretase 2; BACE2, aspartic protease, hydrol | 100.0 | |
| 3vf3_A | 402 | Beta-secretase 1; structure-based drug design, hyd | 100.0 | |
| 3lpj_A | 455 | Beta-secretase 1; alzheimer'S, aspartyl protease, | 100.0 | |
| 2qp8_A | 395 | Beta-secretase 1; BACE1, protease, alternative spl | 100.0 | |
| 3aup_A | 403 | SBG7S, BG, basic 7S globulin; pepsin-like fold, pl | 100.0 | |
| 1b5f_A | 239 | Protein (cardosin A); hydrolase, aspartic proteina | 100.0 | |
| 3vla_A | 413 | EDGP; extracellular, inhibitor, plant protein; HET | 99.97 | |
| 1t6e_X | 381 | Xylanase inhibitor; two beta-barrel domain structu | 99.95 | |
| 1lya_B | 241 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 99.93 | |
| 1lya_A | 97 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 99.67 | |
| 1b5f_B | 87 | Protein (cardosin A); hydrolase, aspartic proteina | 98.05 | |
| 2hs1_A | 99 | HIV-1 protease; ultra-high resolution active site | 93.12 | |
| 1fmb_A | 104 | EIAV protease; hydrolase (acid proteinase), RNA-di | 92.3 | |
| 3liy_A | 116 | Protease; hydrolase, hydrolase-hydrolase inhibitor | 92.19 | |
| 2i1a_A | 148 | DNA damage-inducible protein DDI1; acid protease f | 91.8 | |
| 3ec0_A | 99 | Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1 | 91.6 | |
| 3s8i_A | 148 | Protein DDI1 homolog 1; protease, structural genom | 89.58 | |
| 2i1a_A | 148 | DNA damage-inducible protein DDI1; acid protease f | 87.9 | |
| 3s8i_A | 148 | Protein DDI1 homolog 1; protease, structural genom | 87.89 | |
| 2hah_A | 116 | Protease, retropepsin; retroviral, aspartyl, hydro | 87.8 | |
| 3sqf_A | 114 | Protease; folded monomer, retropepsin, D-type retr | 87.28 | |
| 3slz_A | 132 | GAG-Pro-POL polyprotein; beta sheet and dimer, pro | 85.31 | |
| 1bxo_A | 323 | Protein (penicillopepsin); hydrolase, phosphonate | 84.23 | |
| 1izd_A | 323 | Aspartic proteinase; sugar binding, acid protease, | 82.39 | |
| 1ibq_A | 325 | Aspergillopepsin; aspartic proteinase, hydrolase; | 82.11 | |
| 1lya_A | 97 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 81.64 | |
| 2rsp_A | 124 | RSV protease; hydrolase(aspartyl proteinase); 2.00 | 81.41 |
| >3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.8e-42 Score=278.52 Aligned_cols=175 Identities=39% Similarity=0.841 Sum_probs=152.6
Q ss_pred CccccCceEEEEEEeCCCCceEEEEEecCCCceEEeCCCCCCCCCCCCCCC-----------------------------
Q psy3212 1 MRSSYQAQYYGTISLGTPPQEFKVIFDTGSSNLWIPSQHCSILNIACSVDK----------------------------- 51 (177)
Q Consensus 1 l~~~~~~~y~~~i~iGtP~q~~~v~~DTGS~~~wv~~~~c~~~~~~c~~~~----------------------------- 51 (177)
|+|+.|.+|+++|+||||||+|.|++||||+++||+|..|. +..|..|.
T Consensus 50 l~n~~d~~Y~~~i~iGTPpQ~~~v~~DTGSs~lWV~s~~C~--~~~C~~~~~y~~~~SsT~~~~~~~~~i~Yg~Gs~~G~ 127 (370)
T 3psg_A 50 LENYLDTEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCS--SLACSDHNQFNPDDSSTFEATSQELSITYGTGSMTGI 127 (370)
T ss_dssp TGGGTTCCEEEEEEETTTTEEEEEEEETTCCCEEEEBTTCC--SGGGTTSCCBCGGGCTTCEEEEEEEEEESSSCEEEEE
T ss_pred ceeccCCEEEEEEEEcCCCCEEEEEEeCCCCccEEECCCCC--CcccCCCCCCCCccCcCcEECCcEEEEEeCCceEEEE
Confidence 68999999999999999999999999999999999999997 55777654
Q ss_pred ---C----------------------------cCCC----------------------------cccc---ccCCCCCCc
Q psy3212 52 ---D----------------------------KFVG----------------------------HSHF---RNASDENGG 69 (177)
Q Consensus 52 ---D----------------------------~fdG----------------------------~~~F---~~~~~~~~G 69 (177)
| ++|| +++| +.......|
T Consensus 128 ~~~Dtv~ig~~~v~~~~Fg~a~~~~~~~~~~~~~dGIlGLg~~~~s~~~~~~~~~~l~~qg~i~~~~FS~~L~~~~~~~G 207 (370)
T 3psg_A 128 LGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISASGATPVFDNLWDQGLVSQDLFSVYLSSNDDSGS 207 (370)
T ss_dssp EEEEEEEETTEEEEEEEEEEECSCCCGGGGGCSCSEEEECSCGGGCGGGCCCHHHHHHHTTCSSSSEEEEEEC-----CE
T ss_pred EEEEEEeeCCcccCCeEEEEEEeecccccccCCccceeccCCccccccCCCCHHHHHHHCCCCCCCEEEEEEccCCCCCe
Confidence 1 2455 3455 222345689
Q ss_pred EEEEcccCCCCeeeeeeEEecCcccceEEEEeEEEEcCeEec--CCcEEEEeCCCCcEEeCHHHHHHHHHHhCCccCCCC
Q psy3212 70 EIMFGGVDKDKFVGDITYSPVSRKGYWQFGVESIKIEKNVYC--SNCQAIADTGTSLIIGPSKVIAELNKLIGAVPLANG 147 (177)
Q Consensus 70 ~l~fGg~d~~~~~g~l~~~p~~~~~~w~v~~~~i~v~~~~~~--~~~~ai~DSGt~~~~lP~~~~~~l~~~~~~~~~~~g 147 (177)
+|+|||+|+++|.|++.|+|+.+..+|.|.+++|+++++.+. .+..|++||||+++++|++++++|.+++++.....|
T Consensus 208 ~l~fGg~D~~~y~g~l~~~pv~~~~~w~v~l~~i~v~g~~~~~~~~~~aiiDTGTs~~~lP~~~~~~i~~~i~a~~~~~g 287 (370)
T 3psg_A 208 VVLLGGIDSSYYTGSLNWVPVSVEGYWQITLDSITMDGETIACSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASENSDG 287 (370)
T ss_dssp EEEETCCCGGGBSSCCEEEECSEETTEEEEECEEESSSSEEECTTCEEEEECTTCCSEEEEHHHHHHHHHHTTCEECTTC
T ss_pred EEEEEeeChHhcCCcceeecccccceeEEEEeEEEECCEEEecCCCceEEEcCCCCcEECCHHHHHHHHHHhCCcccCCC
Confidence 999999999999999999999999999999999999998764 778999999999999999999999999999866788
Q ss_pred CEEEcCCCCCCCccEEEEECCEEEEeccCC
Q psy3212 148 PAKVDCDNLDKMPNVDIILGGKNFTLTRTN 177 (177)
Q Consensus 148 ~~~~~C~~~~~~p~l~f~~gg~~~~l~~~d 177 (177)
.|.++|+...++|+|+|+|+|++++||+++
T Consensus 288 ~~~v~C~~~~~lP~i~f~~~g~~~~l~~~~ 317 (370)
T 3psg_A 288 EMVISCSSIDSLPDIVFTIDGVQYPLSPSA 317 (370)
T ss_dssp CEECCGGGGGGCCCEEEEETTEEEEECHHH
T ss_pred cEEEECCCcccCCcEEEEECCEEEEECHHH
Confidence 999999988889999999999999999864
|
| >2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} | Back alignment and structure |
|---|
| >4aa9_A Chymosin; hydrolase, aspartic peptidase, rennet; HET: NAG; 1.60A {Camelus dromedarius} PDB: 4aa8_A 1czi_E* 1cms_A 4cms_A 3cms_A | Back alignment and structure |
|---|
| >3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A | Back alignment and structure |
|---|
| >1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* | Back alignment and structure |
|---|
| >1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... | Back alignment and structure |
|---|
| >1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A | Back alignment and structure |
|---|
| >3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* | Back alignment and structure |
|---|
| >1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 | Back alignment and structure |
|---|
| >1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* | Back alignment and structure |
|---|
| >3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* | Back alignment and structure |
|---|
| >2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... | Back alignment and structure |
|---|
| >1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... | Back alignment and structure |
|---|
| >2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A | Back alignment and structure |
|---|
| >1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* | Back alignment and structure |
|---|
| >1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* | Back alignment and structure |
|---|
| >2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} | Back alignment and structure |
|---|
| >3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} SCOP: b.50.1.2 PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* | Back alignment and structure |
|---|
| >3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} SCOP: b.50.1.0 PDB: 3tne_A* | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A | Back alignment and structure |
|---|
| >1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3vf3_A Beta-secretase 1; structure-based drug design, hydrolase-hydrolase inhibitor C; HET: 0GS; 1.48A {Homo sapiens} PDB: 2f3e_A* 2f3f_A* 1ym2_A* 3dv1_A* 3dv5_A* 3k5c_A* 3k5f_A* 3k5g_A* 3pi5_A* 3qbh_A* 3duy_A* 3veu_A* 3vg1_A* 4d83_A* 4d88_A* 4d89_A* 4d8c_A* 3msk_A* 3k5d_A* 1ym4_A* ... | Back alignment and structure |
|---|
| >3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 4fse_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* | Back alignment and structure |
|---|
| >2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... | Back alignment and structure |
|---|
| >3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} | Back alignment and structure |
|---|
| >1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >3vla_A EDGP; extracellular, inhibitor, plant protein; HET: NAG; 0.95A {Daucus carota} PDB: 3vlb_A | Back alignment and structure |
|---|
| >1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A | Back alignment and structure |
|---|
| >1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* | Back alignment and structure |
|---|
| >1lya_A Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_A* 1lyw_A* | Back alignment and structure |
|---|
| >1b5f_B Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >2hs1_A HIV-1 protease; ultra-high resolution active site surface binding site, HYDR; HET: 017; 0.84A {Human immunodeficiency virus 1} PDB: 3nu4_A* 3tl9_A* 3tkw_A* 3tkg_A* 3ndu_A* 3ndt_A* 3k4v_A* 3a2o_A* 1fgc_C* 2a1e_A* 2aod_A* 2aoi_A* 2aoj_A* 2hb3_A* 2ien_A* 1sdt_A* 2z4o_A* 2zye_A* 2nmw_A* 3b7v_A* ... | Back alignment and structure |
|---|
| >1fmb_A EIAV protease; hydrolase (acid proteinase), RNA-directed DNA polymerase, AS protease, endonuclease, polyprotein; HET: HYB; 1.80A {Equine infectious anemia virus} SCOP: b.50.1.1 PDB: 2fmb_A* | Back alignment and structure |
|---|
| >3liy_A Protease; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.86A {Human t-lymphotropic virus 1} PDB: 2b7f_A* 3liq_A* 3lit_A* 3liv_A* 3lix_A* 3lin_A* | Back alignment and structure |
|---|
| >2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ec0_A Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1.18A {Human immunodeficiency virus type 2} SCOP: b.50.1.1 PDB: 1hii_A* 1hsi_A 1hsh_A* 1idb_A* 1jld_A* 2mip_A 1ida_A* 3ebz_A* 3ecg_A* 3s45_A* 4upj_A* 1ivq_A* 1ivp_A 2hpf_A 3upj_A* 2hpe_A* 5upj_A* 6upj_A* 1sip_A 1tcw_A* ... | Back alignment and structure |
|---|
| >3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2hah_A Protease, retropepsin; retroviral, aspartyl, hydrolase-hydrolase complex; HET: 3TL; 1.70A {Feline immunodeficiency virus} PDB: 3ogp_A* 3ogq_A* 2fiv_A* 6fiv_A* 3fiv_A* 5fiv_A* 4fiv_A* 1fiv_A* 1b11_A* | Back alignment and structure |
|---|
| >3sqf_A Protease; folded monomer, retropepsin, D-type retrovirus; 1.63A {Mason-pfizer monkey virus} SCOP: b.50.1.1 PDB: 1nso_A | Back alignment and structure |
|---|
| >3slz_A GAG-Pro-POL polyprotein; beta sheet and dimer, protease, peptide inhibitor, TL-3 PEPS virus, hydrolase-hydrolase inhibitor complex; HET: 3TL; 1.40A {Dg-75 murine leukemia virus} PDB: 3nr6_A* 3sm1_A* 3sm2_A* 4exh_A* | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1lya_A Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_A* 1lyw_A* | Back alignment and structure |
|---|
| >2rsp_A RSV protease; hydrolase(aspartyl proteinase); 2.00A {Rous sarcoma virus} SCOP: b.50.1.1 PDB: 1mvp_A 1bai_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 177 | ||||
| d3psga_ | 370 | b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxI | 5e-21 | |
| d3psga_ | 370 | b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxI | 2e-11 | |
| d1dpja_ | 329 | b.50.1.2 (A:) Acid protease {Baker's yeast (Saccha | 1e-20 | |
| d1dpja_ | 329 | b.50.1.2 (A:) Acid protease {Baker's yeast (Saccha | 9e-15 | |
| g1htr.1 | 372 | b.50.1.2 (P:,B:) Pepsin(ogen) {Human (Homo sapiens | 5e-20 | |
| g1htr.1 | 372 | b.50.1.2 (P:,B:) Pepsin(ogen) {Human (Homo sapiens | 4e-13 | |
| d1smra_ | 335 | b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mu | 2e-18 | |
| d1smra_ | 335 | b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mu | 2e-16 | |
| d2apra_ | 325 | b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus | 4e-18 | |
| d2apra_ | 325 | b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus | 2e-14 | |
| d1wkra_ | 340 | b.50.1.2 (A:) Acid protease {Irpex lacteus (Polypo | 6e-18 | |
| d1wkra_ | 340 | b.50.1.2 (A:) Acid protease {Irpex lacteus (Polypo | 1e-15 | |
| g1b5f.1 | 326 | b.50.1.2 (A:,B:) Plant acid proteinase, phytepsin | 6e-18 | |
| g1b5f.1 | 326 | b.50.1.2 (A:,B:) Plant acid proteinase, phytepsin | 8e-14 | |
| d1am5a_ | 324 | b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus mo | 2e-17 | |
| d1am5a_ | 324 | b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus mo | 9e-15 | |
| d3cmsa_ | 323 | b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos | 9e-17 | |
| d3cmsa_ | 323 | b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos | 4e-14 | |
| g1lya.1 | 338 | b.50.1.2 (A:,B:) Cathepsin D {Human (Homo sapiens) | 2e-16 | |
| g1lya.1 | 338 | b.50.1.2 (A:,B:) Cathepsin D {Human (Homo sapiens) | 5e-16 | |
| d1j71a_ | 334 | b.50.1.2 (A:) Acid protease {Yeast (Candida tropic | 2e-16 | |
| d1j71a_ | 334 | b.50.1.2 (A:) Acid protease {Yeast (Candida tropic | 8e-15 | |
| d1miqa_ | 373 | b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading e | 2e-16 | |
| d1miqa_ | 373 | b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading e | 8e-15 | |
| d1hrna_ | 337 | b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Ho | 3e-16 | |
| d1hrna_ | 337 | b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Ho | 2e-14 | |
| d1qdma2 | 337 | b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase | 8e-16 | |
| d1qdma2 | 337 | b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase | 2e-14 | |
| d1eaga_ | 342 | b.50.1.2 (A:) Acid protease {Yeast (Candida albica | 1e-15 | |
| d1eaga_ | 342 | b.50.1.2 (A:) Acid protease {Yeast (Candida albica | 9e-12 | |
| d1oewa_ | 330 | b.50.1.2 (A:) Endothiapepsin {Chestnut blight fung | 3e-15 | |
| d1oewa_ | 330 | b.50.1.2 (A:) Endothiapepsin {Chestnut blight fung | 2e-13 | |
| d1izea_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Aspergillus o | 3e-15 | |
| d1izea_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Aspergillus o | 3e-11 | |
| d2bjua1 | 329 | b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrad | 4e-15 | |
| d2bjua1 | 329 | b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrad | 2e-14 | |
| d1mppa_ | 357 | b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840] | 3e-14 | |
| d1mppa_ | 357 | b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840] | 2e-09 | |
| d2qp8a1 | 387 | b.50.1.2 (A:60-446) beta-secretase (memapsin) {Hum | 1e-13 | |
| d2qp8a1 | 387 | b.50.1.2 (A:60-446) beta-secretase (memapsin) {Hum | 1e-12 | |
| d1bxoa_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Penicillium j | 3e-11 | |
| d1bxoa_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Penicillium j | 1e-10 | |
| d1t6ex_ | 381 | b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Tr | 1e-07 |
| >d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Length = 370 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Acid proteases superfamily: Acid proteases family: Pepsin-like domain: Pepsin(ogen) species: Pig (Sus scrofa) [TaxId: 9823]
Score = 86.2 bits (212), Expect = 5e-21
Identities = 39/119 (32%), Positives = 70/119 (58%), Gaps = 2/119 (1%)
Query: 58 SHFRNASDENGGEIMFGGVDKDKFVGDITYSPVSRKGYWQFGVESIKIEKNVYC--SNCQ 115
S + +++D++G ++ GG+D + G + + PVS +GYWQ ++SI ++ CQ
Sbjct: 196 SVYLSSNDDSGSVVLLGGIDSSYYTGSLNWVPVSVEGYWQITLDSITMDGETIACSGGCQ 255
Query: 116 AIADTGTSLIIGPSKVIAELNKLIGAVPLANGPAKVDCDNLDKMPNVDIILGGKNFTLT 174
AI DTGTSL+ GP+ IA + IGA ++G + C ++D +P++ + G + L+
Sbjct: 256 AIVDTGTSLLTGPTSAIANIQSDIGASENSDGEMVISCSSIDSLPDIVFTIDGVQYPLS 314
|
| >d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Length = 370 | Back information, alignment and structure |
|---|
| >d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Length = 329 | Back information, alignment and structure |
|---|
| >d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Length = 329 | Back information, alignment and structure |
|---|
| >d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Length = 335 | Back information, alignment and structure |
|---|
| >d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Length = 335 | Back information, alignment and structure |
|---|
| >d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Length = 325 | Back information, alignment and structure |
|---|
| >d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Length = 325 | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Length = 340 | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Length = 340 | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Length = 324 | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Length = 324 | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Length = 323 | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Length = 323 | Back information, alignment and structure |
|---|
| >d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 334 | Back information, alignment and structure |
|---|
| >d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 334 | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Length = 373 | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Length = 373 | Back information, alignment and structure |
|---|
| >d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 337 | Back information, alignment and structure |
|---|
| >d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 337 | Back information, alignment and structure |
|---|
| >d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Length = 342 | Back information, alignment and structure |
|---|
| >d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Length = 342 | Back information, alignment and structure |
|---|
| >d1oewa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} Length = 330 | Back information, alignment and structure |
|---|
| >d1oewa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} Length = 330 | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Length = 323 | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Length = 323 | Back information, alignment and structure |
|---|
| >d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Length = 329 | Back information, alignment and structure |
|---|
| >d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Length = 329 | Back information, alignment and structure |
|---|
| >d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Length = 357 | Back information, alignment and structure |
|---|
| >d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Length = 357 | Back information, alignment and structure |
|---|
| >d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Length = 387 | Back information, alignment and structure |
|---|
| >d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Length = 387 | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Length = 323 | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Length = 323 | Back information, alignment and structure |
|---|
| >d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 381 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 177 | |||
| d1dpja_ | 329 | Acid protease {Baker's yeast (Saccharomyces cerevi | 100.0 | |
| d3psga_ | 370 | Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d1smra_ | 335 | Chymosin (synonym: renin) {Mouse (Mus musculus) [T | 100.0 | |
| g1htr.1 | 372 | Pepsin(ogen) {Human (Homo sapiens), progastricsin | 100.0 | |
| d2apra_ | 325 | Acid protease {Bread mold (Rhizopus chinensis) [Ta | 100.0 | |
| d1oewa_ | 330 | Endothiapepsin {Chestnut blight fungus (Endothia p | 100.0 | |
| d1hrna_ | 337 | Chymosin (synonym: renin) {Human (Homo sapiens) [T | 100.0 | |
| d1miqa_ | 373 | Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo | 100.0 | |
| d1am5a_ | 324 | Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: | 100.0 | |
| d1j71a_ | 334 | Acid protease {Yeast (Candida tropicalis) [TaxId: | 100.0 | |
| g1lya.1 | 338 | Cathepsin D {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1eaga_ | 342 | Acid protease {Yeast (Candida albicans) [TaxId: 54 | 100.0 | |
| d3cmsa_ | 323 | Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId | 100.0 | |
| d1wkra_ | 340 | Acid protease {Irpex lacteus (Polyporus tulipifera | 100.0 | |
| d1qdma2 | 337 | Plant acid proteinase, phytepsin {Barley (Hordeum | 100.0 | |
| d2bjua1 | 329 | Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo | 100.0 | |
| d1izea_ | 323 | Acid protease {Fungus (Aspergillus oryzae) [TaxId: | 100.0 | |
| d1mppa_ | 357 | Pepsin {Mucor pusillus [TaxId: 4840]} | 100.0 | |
| d1bxoa_ | 323 | Acid protease {Fungus (Penicillium janthinellum), | 100.0 | |
| g1b5f.1 | 326 | Plant acid proteinase, phytepsin {Cynara carduncul | 100.0 | |
| d2qp8a1 | 387 | beta-secretase (memapsin) {Human (Homo sapiens) [T | 99.97 | |
| d1t6ex_ | 381 | Xylanase inhibitor TAXI-I {Wheat (Triticum aestivu | 99.92 | |
| d1hvca_ | 203 | Human immunodeficiency virus type 1 protease {Huma | 93.59 | |
| d1bxoa_ | 323 | Acid protease {Fungus (Penicillium janthinellum), | 92.7 | |
| d1izea_ | 323 | Acid protease {Fungus (Aspergillus oryzae) [TaxId: | 91.65 | |
| d4fiva_ | 113 | Feline immunodeficiency virus (FIV) protease {Feli | 89.95 | |
| d2nmza1 | 99 | Human immunodeficiency virus type 1 protease {Huma | 89.49 | |
| d2fmba_ | 104 | EIAV protease {Equine infectious anemia virus [Tax | 88.95 | |
| d3ecga1 | 99 | Human immunodeficiency virus type 2 (HIV-2) protea | 88.33 | |
| d3cmsa_ | 323 | Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId | 80.77 |
| >d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Acid proteases superfamily: Acid proteases family: Pepsin-like domain: Acid protease species: Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]
Probab=100.00 E-value=3.5e-39 Score=252.57 Aligned_cols=175 Identities=45% Similarity=0.776 Sum_probs=152.7
Q ss_pred CccccCceEEEEEEeCCCCceEEEEEecCCCceEEeCCCCCCCCCCCCCCC-----------------------------
Q psy3212 1 MRSSYQAQYYGTISLGTPPQEFKVIFDTGSSNLWIPSQHCSILNIACSVDK----------------------------- 51 (177)
Q Consensus 1 l~~~~~~~y~~~i~iGtP~q~~~v~~DTGS~~~wv~~~~c~~~~~~c~~~~----------------------------- 51 (177)
|+|+.|.+|+++|.||||||++.|++||||+++||+|..|.. ..|..+.
T Consensus 7 l~n~~~~~Y~~~i~iGtP~q~~~~~iDTGSs~~Wv~~~~C~~--~~c~~~~~f~~~~Sst~~~~~~~~~~~y~~gs~~G~ 84 (329)
T d1dpja_ 7 LTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGS--LACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGY 84 (329)
T ss_dssp CEEETTTEEEEEEEETTTTEEEEEEEETTCCCEEEEBTTCCS--HHHHTSCCBCGGGCTTCEEEEEEEEEEETTEEEEEE
T ss_pred eEEccCCEEEEEEEEeCCCeEEEEEEECCcccEEEECCCCCC--ccccCCCcCCcccCCceeECCeeEEEEccCceEEEE
Confidence 689999999999999999999999999999999999999972 2333222
Q ss_pred ---C----------------------------cCCC----------------------------cccc------ccCCCC
Q psy3212 52 ---D----------------------------KFVG----------------------------HSHF------RNASDE 66 (177)
Q Consensus 52 ---D----------------------------~fdG----------------------------~~~F------~~~~~~ 66 (177)
| .++| ++.| ......
T Consensus 85 ~~~D~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~Gi~Glg~~~~~~~~~~~~~~~l~~~~~i~~~~fs~~l~~~~~~~~ 164 (329)
T d1dpja_ 85 ISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTE 164 (329)
T ss_dssp EEEEEEEETTEEEEEEEEEEEEECCHHHHTTCSCSEEEECSCGGGCGGGCCCHHHHHHHTTCCSSSEEEEEECCGGGTCS
T ss_pred EEEEEEEecceEEeeEEEEEEeeccCccccccccccccccccCccccccCCchhhhHhhccCcccceEEEEEEecCCCcC
Confidence 1 2233 3445 123446
Q ss_pred CCcEEEEcccCCCCeeeeeeEEecCcccceEEEEeEEEEcCeEec-CCcEEEEeCCCCcEEeCHHHHHHHHHHhCCccCC
Q psy3212 67 NGGEIMFGGVDKDKFVGDITYSPVSRKGYWQFGVESIKIEKNVYC-SNCQAIADTGTSLIIGPSKVIAELNKLIGAVPLA 145 (177)
Q Consensus 67 ~~G~l~fGg~d~~~~~g~l~~~p~~~~~~w~v~~~~i~v~~~~~~-~~~~ai~DSGt~~~~lP~~~~~~l~~~~~~~~~~ 145 (177)
..|.|+|||+|++++.+++.|+|+....+|.|.++++.++++.+. .+..++|||||+++++|++++++|.+++++....
T Consensus 165 ~~g~l~~Gg~d~~~~~~~~~~~~~~~~~~~~v~~~~i~v~~~~~~~~~~~~iiDSGts~~~lp~~~~~~l~~~~~~~~~~ 244 (329)
T d1dpja_ 165 NGGEATFGGIDESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLITLPSGLAEMINAEIGAKKGW 244 (329)
T ss_dssp SSEEEEESSCCGGGEEEEEEEEECSSBTTBEEEEEEEEETTEEEECSSCEEEECTTCSCEEECHHHHHHHHHHHTCEECT
T ss_pred CCCceECCCCchhhccCceeEecccccceeEEEEeeEEECCeEeeeeecccccCcccceeeCCHHHHHHHHHHhCCcccc
Confidence 679999999999999999999999999999999999999999887 8889999999999999999999999999988777
Q ss_pred CCCEEEcCCCCCCCccEEEEECCEEEEeccCC
Q psy3212 146 NGPAKVDCDNLDKMPNVDIILGGKNFTLTRTN 177 (177)
Q Consensus 146 ~g~~~~~C~~~~~~p~l~f~~gg~~~~l~~~d 177 (177)
.+.|.++|+...++|+|+|+|+|++++|+|++
T Consensus 245 ~~~~~~~c~~~~~~P~i~f~f~g~~~~l~p~~ 276 (329)
T d1dpja_ 245 TGQYTLDCNTRDNLPDLIFNFNGYNFTIGPYD 276 (329)
T ss_dssp TSSEEECGGGGGGCCCEEEEETTEEEEECTTT
T ss_pred ceeEEEeccccCccceEEEEECCEEEEECHHH
Confidence 88999999987789999999999999999986
|
| >d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} | Back information, alignment and structure |
|---|
| >d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} | Back information, alignment and structure |
|---|
| >d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} | Back information, alignment and structure |
|---|
| >d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} | Back information, alignment and structure |
|---|
| >d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} | Back information, alignment and structure |
|---|
| >d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} | Back information, alignment and structure |
|---|
| >d1hvca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} | Back information, alignment and structure |
|---|
| >d4fiva_ b.50.1.1 (A:) Feline immunodeficiency virus (FIV) protease {Feline immunodeficiency virus [TaxId: 11673]} | Back information, alignment and structure |
|---|
| >d2nmza1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d2fmba_ b.50.1.1 (A:) EIAV protease {Equine infectious anemia virus [TaxId: 11665]} | Back information, alignment and structure |
|---|
| >d3ecga1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|