Diaphorina citri psyllid: psy3215


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MILHKITKLREHWDETNNKVMARKTQLDSMLSDSQRYDAKRQEVDGWLTRMENRMQRMNPVGYTADVLEVQLREQKSIHADLHQFKQQIVLFNQLTQKLISVYQHDDTTRVKKITEQVNQRYNNLNTSIINRGKALNSAMSSLQNFDKSIDNFLAWLSEAESTMECVEVETDRQAEKQSTPLLKVP
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcccccHHHHHHccccccc
MILHKITKLREHWDETNNKVMARKTQLDSMLSDSQRYDAKRQEVDGWLTRMEN***RMNPVGYTADVLEVQLREQKSIHADLHQFKQQIVLFNQLTQKLISVYQHDDTTRVKKITEQVNQRYNNLNTSIINRGKALNSAMSSLQNFDKSIDNFLAWLSEAE*************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILHKITKLREHWDETNNKVMARKTQLDSMLSDSQRYDAKRQEVDGWLTRMENRMQRMNPVGYTADVLEVQLREQKSIHADLHQFKQQIVLFNQLTQKLISVYQHDDTTRVKKITEQVNQRYNNLNTSIINRGKALNSAMSSLQNFDKSIDNFLAWLSEAESTMECVEVETDRQAEKQSTPLLKVP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dystrophin, isoforms A/C/F/G/H Required for the maintenance of appropriate synaptic retrograde communication and the stabilization of muscle cell architecture or physiology. Both det and Dg are required for maintenance of early dpp signaling in the presumptive crossvein. Isoform A is not required to maintain muscle integrity, but plays a role in neuromuscular homeostasis by regulating neurotransmitter release. May play a role in anchoring the cytoskeleton to the plasma membrane.confidentQ9VDW6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046928 [BP]regulation of neurotransmitter secretionprobableGO:0032879, GO:0051046, GO:0060341, GO:0010646, GO:0051049, GO:0050794, GO:0008150, GO:0031644, GO:0044057, GO:0065007, GO:0051239, GO:0023051, GO:0051588, GO:0051969, GO:0050804, GO:0050789
GO:0007274 [BP]neuromuscular synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007268, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0048172 [BP]regulation of short-term neuronal synaptic plasticityprobableGO:0010646, GO:0044057, GO:0031644, GO:0050804, GO:0050789, GO:0048167, GO:0065007, GO:0051239, GO:0023051, GO:0008150, GO:0051969, GO:0065008, GO:0048168, GO:0050794
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EDV, chain A
Confidence level:very confident
Coverage over the Query: 2-167
View the alignment between query and template
View the model in PyMOL