Diaphorina citri psyllid: psy3251

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------96

MSVDAYGPSSQTLTFLDTEETDLIGGDTQGSEFDFTDFTLPSQSQTQASQLDSVNQIQVNGKQNLDNSNLNLVSQKLHELQFEEEEDDGNEFFNKELPPHACKYCGIHDPAYVIMCNICKKWFCNGRGHTSGSHIINHLVRAKHKEVTLHKDGPLGETVLECYTCGVRNIFVLGFIPAKADSVVVLLCRTPCAAQNSLKDMNWDQEQWKPLIADRSFLSWLVKVPTEQEQQRGRQVTSAQIAKLEEVWKDNAEATFQDLEKPGVDEDPHQVLLRYEDGYQYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDGYQYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDMRLMQGDELKLRYSYDASKTWSGLGHVIKIPDNFGDEVGLELKSSAGAPTEATTGFSVDFIWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGPPGTGKTVTSATIVYQLVKQTGSPVLVCAPSNIAVDQLTEKIHRTGLKVVRVCAKSREAIDSPVSFLALHNQIRNMEMNSELKKLLQLKEETGELSSADEKRYRMLKKNAEKSLLDNADVICCTCVGAGDPRLLKIKFHSILIDESMQATEPECMVPVILGAKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFRLEVQYRMHPELSKFPSNFFYEGSLQNGVCADERKLSKIDFPWPVPDKPMLFYVTQGQEEIAGSGTSYVNRTEASNVEKITTRFIRCGMKPEQIGVITPYEGQRAFLVQHMQYQGSLPAKIYQEIEVASVDAFQGREKDLIIMSCVRSNDHQGIGFLNDPRRLNVALTRAKYGIIVIGNPKVLSKQPLWNNLLNFYKEQKVLVEGPLNNLKESLILFSKPKQYFKKNNM

ccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccEEEccccccEEEcccccccccHHHHHHHHccccEEEEcccccccccEEEEcccccccEEEEEcEEcccccEEEEEEccccccccccccccccccccccccccccccccccccccHHHHHHcccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHcccccHHHHHHHHHHHHHHcccccCEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccEEEEEEEEcccccccccccccEEEEEEccccccccCEEEEEEEECcccCEEEEEEEccccccccccccccEEEEEEcccHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccEEEEcccccccHHHHHHHHHccccEEEEEccccccccEEEcHHHHHccccccHHHHHHHcccccEEEEccccccHHHHccccHHHcccccccccccccccccccccccccccccEEEEEccccEEEcccccccccHHHHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHcccccccccccEEEccccccccccccEEEEEEccccccccccccccccccEEEEccccccEEEEcccccccccHHHHHHHHHHHHcccEEEccccccccccccccccccccccccc

********SSQTLTFLDTEETDLIGGDTQGSEFDFTDFT*******************************************************KELPPHACKYCGIHDPAYVIMCNICKKWFCNGRGHTSGSHIINHLVRAKHKEVTLHKDGPLGETVLECYTCGVRNIFVLGFIPAKADSVVVLLCRTPCAAQNSLKDMNWDQEQWKPLIADRSFLSWLVKVP****************AKLEEVWKDNAEATFQDLEKP******HQVLLRYEDGYQYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDGYQYQNIFGPLVKLEADYDKRLK***TQENVTVRWDVGLNKKSIAYFSLAKTDGDMRLMQGDELKLRYSYDASKTWSGLGHVIKIPDNFGDEVGLELKSSAGAPTEATTGFSVDFIWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGPPGTGKTVTSATIVYQLVKQTGSPVLVCAPSNIAVDQLTEKIHRTGLKVVRVCAKSREAIDSPVSFLALHNQIR**********************SADEKRYRMLKKNAEKSLLDNADVICCTCVGAGDPRLLKIKFHSILIDESMQATEPECMVPVILGAKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFRLEVQYRMHPELSKFPSNFFYEGSLQNGVCADERKLSKIDFPWPVPDKPMLFYVTQGQEEIAGSGTSYVNRTEASNVEKITTRFIRCGMKPEQIGVITPYEGQRAFLVQHMQYQGSLPAKIYQEIEVASVDAFQGREKDLIIMSCVRSNDHQGIGFLNDPRRLNVALTRAKYGIIVIGNPKVLSKQPLWNNLLNFYKEQKVLVEGPLNNLKESLILFS***********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Regulator of nonsense transcripts 1 homolog	RNA-dependent helicase and ATPase required for nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Is recruited to mRNAs upon translation termination and undergoes a cycle of phosphorylation and dephosphorylation; its phosphorylation appears to be a key step in NMD. The formation of an Upf1-Upf2-Upf3 surveillance complex is believed to activate NMD.	very confident	Q9VYS3
ATP-dependent helicase upf1	Eliminates the production of nonsense-containing RNAs.	very confident	Q09820
ATP-dependent helicase NAM7	Probable helicase involved in mitochondrial functions. Required for rapid turnover of mRNAs containing a premature translational termination codon.	very confident	P30771

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043231 [CC]	intracellular membrane-bounded organelle	confident	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006281 [BP]	DNA repair	probable	GO:0090304, GO:0034641, GO:0006807, GO:0044699, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044530 [CC]	supraspliceosomal complex	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0004004 [MF]	ATP-dependent RNA helicase activity	probable	GO:0016787, GO:0016818, GO:0008026, GO:0042623, GO:0003824, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0003724, GO:0003674, GO:0016887, GO:0008186, GO:0016462
GO:0000785 [CC]	chromatin	probable	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0035145 [CC]	exon-exon junction complex	probable	GO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0003682 [MF]	chromatin binding	probable	GO:0003674, GO:0005488
GO:0071044 [BP]	histone mRNA catabolic process	probable	GO:0008334, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0006402, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0000956, GO:0019439
GO:0009048 [BP]	dosage compensation by inactivation of X chromosome	probable	GO:0007549, GO:0019222, GO:0060255, GO:0040029, GO:0010468, GO:0065007, GO:0008150, GO:0050789
GO:0006452 [BP]	translational frameshifting	probable	GO:0071704, GO:0044267, GO:0044238, GO:0008152, GO:0044260, GO:1901576, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:0006414, GO:0006412
GO:0007049 [BP]	cell cycle	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0035195 [BP]	gene silencing by miRNA	probable	GO:0010605, GO:0019222, GO:0035194, GO:0010608, GO:0009987, GO:0040029, GO:0050789, GO:0008150, GO:0060255, GO:0016458, GO:0065007, GO:0044763, GO:0031047, GO:0010629, GO:0048519, GO:0016441, GO:0009892, GO:0010468, GO:0044699
GO:0000932 [CC]	cytoplasmic mRNA processing body	probable	GO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0006415 [BP]	translational termination	probable	GO:0043933, GO:0044249, GO:0034645, GO:0043241, GO:0044699, GO:0044267, GO:0032984, GO:0044260, GO:0016043, GO:0008150, GO:0071704, GO:0010467, GO:0071840, GO:1901576, GO:0009987, GO:0009058, GO:0009059, GO:0044763, GO:0008152, GO:0043624, GO:0044238, GO:0071822, GO:0019538, GO:0044237, GO:0043170, GO:0022411, GO:0006412
GO:0030466 [BP]	chromatin silencing at silent mating-type cassette	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0040029, GO:0010629, GO:0050789, GO:0044699, GO:0010605, GO:0019222, GO:0006342, GO:2000112, GO:2000113, GO:0008150, GO:0060255, GO:0016458, GO:0065007, GO:0048519, GO:0045814, GO:0010468, GO:0045934, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0044763, GO:0010558, GO:0048523
GO:0071456 [BP]	cellular response to hypoxia	probable	GO:0009628, GO:0051716, GO:0070887, GO:0036293, GO:0050896, GO:0009987, GO:0071453, GO:0036294, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0042221, GO:0001666, GO:0044699, GO:0070482
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0008298 [BP]	intracellular mRNA localization	probable	GO:0006403, GO:0070727, GO:0009987, GO:0044763, GO:0008150, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0008270 [MF]	zinc ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0003677 [MF]	DNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0000184 [BP]	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0006402, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0000956, GO:0019439
GO:0009506 [CC]	plasmodesma	probable	GO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0006260 [BP]	DNA replication	probable	GO:0071704, GO:1901576, GO:0044238, GO:0008152, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0044249, GO:0009058, GO:0009059, GO:0006807, GO:0034645, GO:0006259, GO:0008150, GO:1901360, GO:0046483
GO:0006449 [BP]	regulation of translational termination	probable	GO:0032268, GO:0009889, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0051128, GO:0050789, GO:0010556, GO:0065007, GO:0008150, GO:0031326, GO:0006417, GO:0043244, GO:0050794, GO:0010468
GO:0016246 [BP]	RNA interference	probable	GO:0010605, GO:0019222, GO:0035194, GO:0010608, GO:0009987, GO:0040029, GO:0050789, GO:0008150, GO:0060255, GO:0016458, GO:0065007, GO:0044763, GO:0031047, GO:0010629, GO:0048519, GO:0016441, GO:0009892, GO:0010468, GO:0044699
GO:0005844 [CC]	polysome	probable	GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529
GO:0003723 [MF]	RNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0009790 [BP]	embryo development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0006406 [BP]	mRNA export from nucleus	probable	GO:0015931, GO:0051169, GO:0051168, GO:0016482, GO:0051028, GO:0044699, GO:0071705, GO:0071702, GO:0033036, GO:0006405, GO:0009987, GO:0006810, GO:0006913, GO:0044763, GO:0051649, GO:0051236, GO:0051234, GO:0051179, GO:0051641, GO:0050658, GO:0006403, GO:0046907, GO:0050657, GO:0008150
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WJY, chain A
Confidence level:very confident
Coverage over the Query: 95-197,208-330,386-947
View the alignment between query and template
View the model in PyMOL

Template: 2WJV, chain A
Confidence level:very confident
Coverage over the Query: 97-268,306-313,332-945
View the alignment between query and template
View the model in PyMOL