Psyllid ID: psy3251


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------96
MSVDAYGPSSQTLTFLDTEETDLIGGDTQGSEFDFTDFTLPSQSQTQASQLDSVNQIQVNGKQNLDNSNLNLVSQKLHELQFEEEEDDGNEFFNKELPPHACKYCGIHDPAYVIMCNICKKWFCNGRGHTSGSHIINHLVRAKHKEVTLHKDGPLGETVLECYTCGVRNIFVLGFIPAKADSVVVLLCRTPCAAQNSLKDMNWDQEQWKPLIADRSFLSWLVKVPTEQEQQRGRQVTSAQIAKLEEVWKDNAEATFQDLEKPGVDEDPHQVLLRYEDGYQYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDGYQYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDMRLMQGDELKLRYSYDASKTWSGLGHVIKIPDNFGDEVGLELKSSAGAPTEATTGFSVDFIWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGPPGTGKTVTSATIVYQLVKQTGSPVLVCAPSNIAVDQLTEKIHRTGLKVVRVCAKSREAIDSPVSFLALHNQIRNMEMNSELKKLLQLKEETGELSSADEKRYRMLKKNAEKSLLDNADVICCTCVGAGDPRLLKIKFHSILIDESMQATEPECMVPVILGAKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFRLEVQYRMHPELSKFPSNFFYEGSLQNGVCADERKLSKIDFPWPVPDKPMLFYVTQGQEEIAGSGTSYVNRTEASNVEKITTRFIRCGMKPEQIGVITPYEGQRAFLVQHMQYQGSLPAKIYQEIEVASVDAFQGREKDLIIMSCVRSNDHQGIGFLNDPRRLNVALTRAKYGIIVIGNPKVLSKQPLWNNLLNFYKEQKVLVEGPLNNLKESLILFSKPKQYFKKNNM
ccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccEEEccccccEEEccccccccHHHHHHHHHccccEEEEcccccccccEEEEcccccccEEEEEcEEcccccEEEEEEccccccccccccccccccccccccccccccccccccccHHHHHHcccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHcccccHHHHHHHHHHHHHHcccccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccEEEEEEEEcccccccccccccEEEEEEccccccccEEEEEEEEEEcccEEEEEEEEccccccccccccccEEEEEEcccHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHccccEEEccccccccHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccEEEEccccccHHHHHHHHHHccccEEEEEccccccccEEEcHHHHHccccccHHHHHHHcccccEEEEccccccHHHHcccHHHHcccccccccccccccccccccccccccccEEEEEccccEEEcccccccccHHHHHHHHHHHHHHHHcccccccEEEEccHHHHHHHHHHHHHHcccccccccccEEEccccccccccccEEEEEEccccccccccccccccccEEEEccccccEEEEcccccccccHHHHHHHHHHHHcccEEEccccccccccccccccccccccccc
cccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccHHHHHHcccccccEEEEEcccccEEEcccccccccHHHHHHHEccccEEEEcccccccccEEEEEccccccEEEEEEEEcccccEEEEEEccccccccccccccccHHHHHHHHHHHcHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHcccccccccccHHHccccHHHHHHHHcHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccccEEEEEEcccccccEEEEcccEEEEEEcccccccccEEEEEEEEccccccEEEEEEcccccccccccccEEEEEEEccccHHHHHHHHHHHHcccccHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccHHccccEcEEEEEccccccccccEHHEEccccEEEEEccccccccEEEcHHHHHccccHHHHHHHHHcccccEEEEEEEcccHHHHccccHHHHcccccccccHHHHcccccccccccccccEEEEEccccEEEcccccccccHHHHHHHHHHHHHHHHccccHHHEEEEcccHHHHHHHHHHHHHcccccHHHcccEEEEEHHccccccccEEEEEEEEccccccEEEccccccEEEEEEEcccEEEEEEcHHHHcccHHHHHHHHHHHHcccEEEcccccccccEEEccccccccccccc
msvdaygpssqtltfldteetdliggdtqgsefdftdftlpsqsqtqasqLDSVNQIQvngkqnldnsnLNLVSQKLHelqfeeeeddgneffnkelpphackycgihdpaYVIMCNICKkwfcngrghtsgshIINHLVRAkhkevtlhkdgplgeTVLECYTCGVRNIFVLGFIPAKADSVVVLLCRtpcaaqnslkdmnwdqeqwkpliadrsFLSWLVkvpteqeqqrgrQVTSAQIAKLEEVWKDNAEATFqdlekpgvdedphqvLLRYedgyqyqnifgpLVKLEADYDKRLkesqtqenVTVRWDVGLNKKSIAYFSLaktdgdgyqyqnifgPLVKLEADYDKRLkesqtqenVTVRWDVGLNKKSIAYFSLAktdgdmrlmqgdelklrysydasktwsglghvikipdnfgdeVGLElkssagapteattgfsvdfiwkstSFDRMQLALRKFAVDDQSVSAYIYHRLLGhnvdevlfrchlpkhfsapnlpdlnrsqVYAVKHAIqrplsliqgppgtgktvtSATIVYQLVKqtgspvlvcapsniavdQLTEKIHRTGLKVVRVCAKsreaidspVSFLALHNQIRNMEMNSELKKLLQLKEETGELSSADEKRYRMLKKNAEKslldnadvicctcvgagdprllkIKFHSILIdesmqatepecmvpVILGAKQLILvgdhcqlgpVVMCKKAARAGLSQSLFERLVVLGIRPFRLEVQyrmhpelskfpsnffyegslqngvcaderklskidfpwpvpdkpmlfyVTQGQeeiagsgtsyvnrteasnveKITTRFIrcgmkpeqigvitpyEGQRAFLVQHMQYqgslpakiYQEIEVASVdafqgrekDLIIMSCVrsndhqgigflndprrLNVALTRAKYgiivignpkvlskqpLWNNLLNFYKEQKVlvegplnnlkeslilfskpkqyfkknnm
msvdaygpssqTLTFLDTEETDLIGGDTQGSEFDFTDFTLPSQSQTQASQLDSVNQIQVNGKQNLDNSNLNLVSQKLHELQFEEEEDDGNEFFNKELPPHACKYCGIHDPAYVIMCNICKKWFCNGRGHTSGSHIINHLVRAKHKEVTLHKDGPLGETVLECYTCGVRNIFVLGFIPAKADSVVVLLCRTPCAAQNSLKDMNWDQEQWKPLIADRSFLSWLVKVpteqeqqrgrqvTSAQIAKLEEVWKDNAEATfqdlekpgvdeDPHQVLLRYEDGYQYQNIFGPLVKLEADYDKRLkesqtqenvtvrwdvglnKKSIAYFSLAKTDGDGYQYQNIFGPLVKLEADYDKRLkesqtqenvtvrwdvglnkkSIAYFslaktdgdmrlMQGDELKLRYSYDASKTWSGLGHVIKIPDNFGDEVGLELKSsagapteattgFSVDFIWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQrplsliqgppgtGKTVTSATIVYQLVKQTGSPVLVCAPSNIAVDQLTEKIHRTGLKVVRVCAKsreaidspvsFLALHNQIRNMEMNSELKKLLQLKEEtgelssadekRYRMLKKNaekslldnadVICCTCVGAGDPRLLKIKFHSILIDESMQATEPECMVPVILGAKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFRLEVQYRMHPELSKFPSNFFYEGSLQNGVCADERKLSKIDFPWPVPDKPMLFYVTQGQEEiagsgtsyvnrteasnvekittrfircgmkPEQIGVITPYEGQRAFLVQHMQYQGSLPAKIYQEIEVASVDAFQGREKDLIIMSCVRSNDHqgigflndprRLNVALTRAKYGIivignpkvlskqPLWNNLLNFYKEQKVLVEGPLNnlkeslilfskpkqyfkknnm
MSVDAYGPSSQtltfldteetdlIGGDTQGSEFDFTDFTLPSQSQTQASQLDSVNQIQVNGKQNLDNSNLNLVSqklhelqfeeeeddgneffnkeLPPHACKYCGIHDPAYVIMCNICKKWFCNGRGHTSGSHIINHLVRAKHKEVTLHKDGPLGETVLECYTCGVRNIFVLGFIPAKADSVVVLLCRTPCAAQNSLKDMNWDQEQWKPLIADRSFLSWLVKVPTEQEQQRGRQVTSAQIAKLEEVWKDNAEATFQDLEKPGVDEDPHQVLLRYEDGYQYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDGYQYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDMRLMQGDELKLRYSYDASKTWSGLGHVIKIPDNFGDEVGLELKSSAGAPTEATTGFSVDFIWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGPPGTGKTVTSATIVYQLVKQTGSPVLVCAPSNIAVDQLTEKIHRTGLKVVRVCAKSREAIDSPVSFLALHNQIRNMEMNSelkkllqlkeetgelSSADEKRYRMLKKNAEKSLLDNADVICCTCVGAGDPRLLKIKFHSILIDESMQATEPECMVPVILGAKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFRLEVQYRMHPELSKFPSNFFYEGSLQNGVCADERKLSKIDFPWPVPDKPMLFYVTQGQEEIAGSGTSYVNRTEASNVEKITTRFIRCGMKPEQIGVITPYEGQRAFLVQHMQYQGSLPAKIYQEIEVASVDAFQGREKDLIIMSCVRSNDHQGIGFLNDPRRLNVALTRAKYGIIVIGNPKVLSKQPLWNNLLNFYKEQKVLVEGPLNNLKESLILFSKPKQYFKKNNM
************************************************************************************************LPPHACKYCGIHDPAYVIMCNICKKWFCNGRGHTSGSHIINHLVRAKHKEVTLHKDGPLGETVLECYTCGVRNIFVLGFIPAKADSVVVLLCRTPCAAQNSLKDMNWDQEQWKPLIADRSFLSWLVKVP****************AKLEEVWKD******************HQVLLRYEDGYQYQNIFGPLVKLEADYDKRLK***TQENVTVRWDVGLNKKSIAYFSLAKTDGDGYQYQNIFGPLVKLEADYDKRLK***TQENVTVRWDVGLNKKSIAYFSLAKTDGDMRLMQGDELKLRYSYDASKTWSGLGHVIKIPDNFGDEVGLELK******TEATTGFSVDFIWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGPPGTGKTVTSATIVYQLVKQTGSPVLVCAPSNIAVDQLTEKIHRTGLKVVRVCAKSREAIDSPVSFLALHNQIR***************************************LLDNADVICCTCVGAGDPRLLKIKFHSILIDESMQATEPECMVPVILGAKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFRLEVQYRMHPELSKFPSNFFYEGSLQNGVCADERKLSKIDFPWPVPDKPMLFYVTQGQEEIAGSGTSYVNRTEASNVEKITTRFIRCGMKPEQIGVITPYEGQRAFLVQHMQYQGSLPAKIYQEIEVASVDAFQGREKDLIIMSCVRSNDHQGIGFLNDPRRLNVALTRAKYGIIVIGNPKVLSKQPLWNNLLNFYKEQKVLVEGPLNNLKESLILFS***********
*****YGPSSQTLTFLDTEETDLIGGDTQGSEFDFTDFT*******************************************************KELPPHACKYCGIHDPAYVIMCNICKKWFCNGRGHTSGSHIINHLVRAKHKEVTLHKDGPLGETVLECYTCGVRNIFVLGFIPAKADSVVVLLCRTPCA*********WDQEQWKPLIADRSFLSWLVKVP****************AKLEEVWKDNAEATFQDLEKP************YEDGYQYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDGYQYQNIFGPLVKLEADYDKR*******ENVTVRWDVGLNKKSIAYFSLAKTDGDMRLMQGDELKLRYSYDASKTWSGLGHVIKIPDNFGDEVGLELKSSAGAPTEATTGFSVDFIWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVL***HLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGPPGTGKTVTSATIVYQLVKQTGSPVLVCAPSNIAVDQLTEKIHRTGLKVVRVCAKSREAIDSPVSFLALH**************************SADEKRYRMLKKNAEKSLLDNADVICCTCVGAGDPRLLKIKFHSILIDESMQATEPECMVPVILGAKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFRLEVQYRMHPELSKFPSNFFYEGSLQNGVCADERKLSKIDFPWPVPDKPMLFYVTQ***************TEASNVEKITTRFIRCGMKPEQIGVITPYEGQRAFLVQHMQYQGSLPAKIYQEIEVASVDAFQGREKDLIIMSCVRSNDHQGIGFLNDPRRLNVALTRAKYGIIVIGNPKVLSKQPLWNNLLNFYKEQKVLVEGPLNN********************
**********QTLTFLDTEETDLIGGDTQGSEFDFTDFTLPS*********DSVNQIQVNGKQNLDNSNLNLVSQKLHELQFEEEEDDGNEFFNKELPPHACKYCGIHDPAYVIMCNICKKWFCNGRGHTSGSHIINHLVRAKHKEVTLHKDGPLGETVLECYTCGVRNIFVLGFIPAKADSVVVLLCRTPCAAQNSLKDMNWDQEQWKPLIADRSFLSWLVKVP*************AQIAKLEEVWKDNAEATFQDLEKPGVDEDPHQVLLRYEDGYQYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDGYQYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDMRLMQGDELKLRYSYDASKTWSGLGHVIKIPDNFGDEVGLELKSSAGAPTEATTGFSVDFIWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGPPGTGKTVTSATIVYQLVKQTGSPVLVCAPSNIAVDQLTEKIHRTGLKVVRVCAKSREAIDSPVSFLALHNQIRNMEMNSELKKLLQLKEETGELSSADEKRYRMLKKNAEKSLLDNADVICCTCVGAGDPRLLKIKFHSILIDESMQATEPECMVPVILGAKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFRLEVQYRMHPELSKFPSNFFYEGSLQNGVCADERKLSKIDFPWPVPDKPMLFYVTQGQEEIAGSGTSYVNRTEASNVEKITTRFIRCGMKPEQIGVITPYEGQRAFLVQHMQYQGSLPAKIYQEIEVASVDAFQGREKDLIIMSCVRSNDHQGIGFLNDPRRLNVALTRAKYGIIVIGNPKVLSKQPLWNNLLNFYKEQKVLVEGPLNNLKESLILFSKPKQYFKKNNM
********SSQTLTFLDTEETDLIGGDTQGSEFDFTDFTL***************************************LQ**EE*DDGNEFFNKELPPHACKYCGIHDPAYVIMCNICKKWFCNGRGHTSGSHIINHLVRAKHKEVTLHKDGPLGETVLECYTCGVRNIFVLGFIPAKADSVVVLLCRTPCAAQNSLKDMNWDQEQWKPLIADRSFLSWLVKVPTEQEQQRGRQVTSAQIAKLEEVWKDNAEATFQDLEKPGVDEDPHQVLLRYEDGYQYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDGYQYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDMRLMQGDELKLRYSYDASKTWSGLGHVIKIPDNFGDEVGLELKSSAGAPTEATTGFSVDFIWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGPPGTGKTVTSATIVYQLVKQTGSPVLVCAPSNIAVDQLTEKIHRTGLKVVRVCAKSREAIDSPVSFLALHNQIRNMEMNSELKKLLQLKEETGELSSADEKRYRMLKKNAEKSLLDNADVICCTCVGAGDPRLLKIKFHSILIDESMQATEPECMVPVILGAKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFRLEVQYRMHPELSKFPSNFFYEGSLQNGVCADERKLSKIDFPWPVPDKPMLFYVTQGQEEIAGSGTSYVNRTEASNVEKITTRFIRCGMKPEQIGVITPYEGQRAFLVQHMQYQGSLPAKIYQEIEVASVDAFQGREKDLIIMSCVRSNDHQGIGFLNDPRRLNVALTRAKYGIIVIGNPKVLSKQPLWNNLLNFYKEQKVLVEGPLNNLKESLILFSKPKQ*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVDAYGPSSQTLTFLDTEETDLIGGDTQGSEFDFTDFTLPSQSQTQASQLDSVNQIQVNGKQNLDNSNLNLVSQKLHELQFEEEEDDGNEFFNKELPPHACKYCGIHDPAYVIMCNICKKWFCNGRGHTSGSHIINHLVRAKHKEVTLHKDGPLGETVLECYTCGVRNIFVLGFIPAKADSVVVLLCRTPCAAQNSLKDMNWDQEQWKPLIADRSFLSWLVKVPTEQEQQRGRQVTSAQIAKLEEVWKDNAEATFQDLEKPGVDEDPHQVLLRYEDGYQYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDGYQYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDMRLMQGDELKLRYSYDASKTWSGLGHVIKIPDNFGDEVGLELKSSAGAPTEATTGFSVDFIWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGPPGTGKTVTSATIVYQLVKQTGSPVLVCAPSNIAVDQLTEKIHRTGLKVVRVCAKSREAIDSPVSFLALHNQIRNMEMNSELKKLLQLKEETGELSSADEKRYRMLKKNAEKSLLDNADVICCTCVGAGDPRLLKIKFHSILIDESMQATEPECMVPVILGAKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFRLEVQYRMHPELSKFPSNFFYEGSLQNGVCADERKLSKIDFPWPVPDKPMLFYVTQGQEEIAGSGTSYVNRTEASNVEKITTRFIRCGMKPEQIGVITPYEGQRAFLVQHMQYQGSLPAKIYQEIEVASVDAFQGREKDLIIMSCVRSNDHQGIGFLNDPRRLNVALTRAKYGIIVIGNPKVLSKQPLWNNLLNFYKEQKVLVEGPLNNLKESLILFSKPKQYFKKNNM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query959 2.2.26 [Sep-21-2011]
Q9VYS3 1180 Regulator of nonsense tra yes N/A 0.936 0.761 0.714 0.0
Q92900 1129 Regulator of nonsense tra yes N/A 0.935 0.794 0.682 0.0
Q9EPU0 1124 Regulator of nonsense tra yes N/A 0.935 0.798 0.683 0.0
Q98TR3 1097 Putative regulator of non N/A N/A 0.933 0.815 0.687 0.0
Q9FJR0 1254 Regulator of nonsense tra yes N/A 0.869 0.665 0.604 0.0
Q9HEH1 1093 Regulator of nonsense tra N/A N/A 0.840 0.737 0.591 0.0
Q09820925 ATP-dependent helicase up yes N/A 0.864 0.896 0.543 0.0
O76512 1069 Regulator of nonsense tra yes N/A 0.927 0.831 0.493 0.0
P30771 971 ATP-dependent helicase NA yes N/A 0.844 0.834 0.519 0.0
Q54I89 1331 Regulator of nonsense tra yes N/A 0.867 0.625 0.483 0.0
>sp|Q9VYS3|RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster GN=Upf1 PE=1 SV=2 Back     alignment and function desciption
 Score = 1417 bits (3669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 690/966 (71%), Positives = 789/966 (81%), Gaps = 68/966 (7%)

Query: 1   MSVDAYGPSSQTLTFLDTEETDLI-GGDTQGSEFDFTDFTLPS--QSQTQASQLDSVNQI 57
           MSVD Y PSS  L+FLD ++ +L+ G DTQ +++D+ DFT+PS  QSQTQ  QL+   + 
Sbjct: 1   MSVDTYAPSS-ALSFLDMDDNELLPGADTQPTQYDYRDFTMPSTSQSQTQNDQLEIAQRC 59

Query: 58  QVNGKQNLDNSNLNLVSQKLHELQFEEEEDDGNEFFNKELPPHACKYCGIHDPAYVIMCN 117
                    +  L  ++  L +LQFEEE+D+    + KELPPHACKYCGIHDPA V+MCN
Sbjct: 60  SAGD----SHPRLASITNDLADLQFEEEDDEPGSSYVKELPPHACKYCGIHDPATVVMCN 115

Query: 118 ICKKWFCNGRGHTSGSHIINHLVRAKHKEVTLHKDGPLGETVLECYTCGVRNIFVLGFIP 177
            C+KWFCNGRG TSGSHIINHLVRAKH+EVTLH +GPLGET+LECY+CGVRN+FVLGFIP
Sbjct: 116 NCRKWFCNGRGSTSGSHIINHLVRAKHREVTLHGEGPLGETILECYSCGVRNVFVLGFIP 175

Query: 178 AKADSVVVLLCRTPCAAQNSLKDMNWDQEQWKPLIADRSFLSWLVKVPTEQEQQRGRQVT 237
           AKADSVVVLLCR PCAAQNSLKDMNWDQEQWKPLIADR FL+WLVK P+EQ Q R RQ++
Sbjct: 176 AKADSVVVLLCRQPCAAQNSLKDMNWDQEQWKPLIADRCFLAWLVKQPSEQGQLRARQIS 235

Query: 238 SAQIAKLEEVWKDNAEATFQDLEKPGVDEDPHQVLLRYEDGYQYQNIFGPLVKLEADYDK 297
           +AQI KLEE+WK+N EATFQDLEKPG+D +P                             
Sbjct: 236 AAQINKLEELWKENIEATFQDLEKPGIDSEP----------------------------- 266

Query: 298 RLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDGYQYQNIFGPLVKLEADYDKRLKES 357
                    +V +R++                  DGYQY+  FGPLV+LEA+YD++LKES
Sbjct: 267 --------AHVLLRYE------------------DGYQYEKTFGPLVRLEAEYDQKLKES 300

Query: 358 QTQENVTVRWDVGLNKKSIAYFSLAKTDGDMRLMQGDELKLRYSYDASKTWSGLGHVIKI 417
            TQEN+ VRWDVGLNKK+IAYF+LAKTD DM+LM GDEL+L Y  +    WS +GHVIK+
Sbjct: 301 ATQENIEVRWDVGLNKKTIAYFTLAKTDSDMKLMHGDELRLHYVGELYNPWSEIGHVIKV 360

Query: 418 PDNFGDEVGLELKSSAGAPTEATTGFSVDFIWKSTSFDRMQLALRKFAVDDQSVSAYIYH 477
           PDNFGD+VGLELKSS  AP + T+ F+VDFIWK TSFDRM  AL KFA+D  SVS +IY 
Sbjct: 361 PDNFGDDVGLELKSSTNAPVKCTSNFTVDFIWKCTSFDRMTRALCKFAIDRNSVSNFIYS 420

Query: 478 RLLGH----NVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGPPGTGKT 533
           RLLGH    + DEVLFR   PK FSAP+LPDLNRSQVYAVKHA+QRPLSLIQGPPGTGKT
Sbjct: 421 RLLGHGRADSNDEVLFRGPQPKLFSAPHLPDLNRSQVYAVKHALQRPLSLIQGPPGTGKT 480

Query: 534 VTSATIVYQLVKQTGSPVLVCAPSNIAVDQLTEKIHRTGLKVVRVCAKSREAIDSPVSFL 593
           VTSATIVYQLVK  G  VLVCAPSN AVDQLTEKIHRT LKVVRVCAKSREAIDSPVSFL
Sbjct: 481 VTSATIVYQLVKLHGGTVLVCAPSNTAVDQLTEKIHRTNLKVVRVCAKSREAIDSPVSFL 540

Query: 594 ALHNQIRNMEMNSELKKLLQLKEETGELSSADEKRYRMLKKNAEKSLLDNADVICCTCVG 653
           ALHNQIRNME NSELKKL QLK+ETGELSSADEKRYR LK+ AE  LL+ ADVICCTCVG
Sbjct: 541 ALHNQIRNMETNSELKKLQQLKDETGELSSADEKRYRNLKRAAENQLLEAADVICCTCVG 600

Query: 654 AGDPRLLKIKFHSILIDESMQATEPECMVPVILGAKQLILVGDHCQLGPVVMCKKAARAG 713
           AGD RL ++KF SILIDESMQ+TEPECMVPV+LGAKQLILVGDHCQLGPVVMCKKAARAG
Sbjct: 601 AGDGRLSRVKFTSILIDESMQSTEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAARAG 660

Query: 714 LSQSLFERLVVLGIRPFRLEVQYRMHPELSKFPSNFFYEGSLQNGVCADERKLSKIDFPW 773
           LSQSLFERLVVLGIRPFRLEVQYRMHPELS+FPSNFFYEGSLQNGVCA++R+L K+DFPW
Sbjct: 661 LSQSLFERLVVLGIRPFRLEVQYRMHPELSQFPSNFFYEGSLQNGVCAEDRRL-KLDFPW 719

Query: 774 PVPDKPMLFYVTQGQEEIAGSGTSYVNRTEASNVEKITTRFIRCGMKPEQIGVITPYEGQ 833
           P P++PM F VTQGQEEIAGSGTS++NRTEA+NVEKITTRF++ G+KPEQIG+ITPYEGQ
Sbjct: 720 PQPERPMFFLVTQGQEEIAGSGTSFLNRTEAANVEKITTRFLKAGIKPEQIGIITPYEGQ 779

Query: 834 RAFLVQHMQYQGSLPAKIYQEIEVASVDAFQGREKDLIIMSCVRSNDHQGIGFLNDPRRL 893
           RA+LVQ+MQYQGSL +++YQEIE+ASVDAFQGREKD+IIMSCVRSN+ QGIGFLNDPRRL
Sbjct: 780 RAYLVQYMQYQGSLHSRLYQEIEIASVDAFQGREKDIIIMSCVRSNERQGIGFLNDPRRL 839

Query: 894 NVALTRAKYGIIVIGNPKVLSKQPLWNNLLNFYKEQKVLVEGPLNNLKESLILFSKPKQY 953
           NVALTRAK+GII++GNPKVL+KQ LWN+LLNFYK++KVLVEG LNNLKESLI F KPK+ 
Sbjct: 840 NVALTRAKFGIIIVGNPKVLAKQQLWNHLLNFYKDRKVLVEGSLNNLKESLIHFQKPKKL 899

Query: 954 FKKNNM 959
               N+
Sbjct: 900 VNSMNI 905




RNA-dependent helicase and ATPase required for nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Is recruited to mRNAs upon translation termination and undergoes a cycle of phosphorylation and dephosphorylation; its phosphorylation appears to be a key step in NMD. The formation of an Upf1-Upf2-Upf3 surveillance complex is believed to activate NMD.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -
>sp|Q92900|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2 Back     alignment and function description
>sp|Q9EPU0|RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2 Back     alignment and function description
>sp|Q98TR3|RENT1_TAKRU Putative regulator of nonsense transcripts 1 OS=Takifugu rubripes GN=rent1 PE=3 SV=1 Back     alignment and function description
>sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 Back     alignment and function description
>sp|Q9HEH1|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1 Back     alignment and function description
>sp|Q09820|RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=upf1 PE=3 SV=2 Back     alignment and function description
>sp|O76512|RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans GN=smg-2 PE=1 SV=1 Back     alignment and function description
>sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1 Back     alignment and function description
>sp|Q54I89|RENT1_DICDI Regulator of nonsense transcripts 1 OS=Dictyostelium discoideum GN=upf1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query959
345491346 1127 PREDICTED: regulator of nonsense transcr 0.939 0.799 0.782 0.0
345491348 1121 PREDICTED: regulator of nonsense transcr 0.939 0.803 0.782 0.0
383847285 1119 PREDICTED: regulator of nonsense transcr 0.937 0.803 0.782 0.0
340721321 1119 PREDICTED: regulator of nonsense transcr 0.939 0.805 0.782 0.0
66553048 1119 PREDICTED: regulator of nonsense transcr 0.939 0.805 0.782 0.0
350406734 1119 PREDICTED: regulator of nonsense transcr 0.939 0.805 0.782 0.0
350406741 1108 PREDICTED: regulator of nonsense transcr 0.935 0.809 0.786 0.0
340721323 1108 PREDICTED: regulator of nonsense transcr 0.935 0.809 0.786 0.0
345491350 1105 PREDICTED: regulator of nonsense transcr 0.925 0.803 0.769 0.0
350406738 1106 PREDICTED: regulator of nonsense transcr 0.925 0.802 0.769 0.0
>gi|345491346|ref|XP_003426577.1| PREDICTED: regulator of nonsense transcripts 1-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score = 1574 bits (4075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 756/966 (78%), Positives = 835/966 (86%), Gaps = 65/966 (6%)

Query: 1   MSVDAYGPSSQTLTFLDTEETDLIGGDTQGSEFDFTDFTLPSQSQTQASQLDSVNQ---- 56
           MSVDAYGPSSQTLTFLDTEE DLIG DTQGSEFDFTDFTLPS SQTQASQ D+       
Sbjct: 1   MSVDAYGPSSQTLTFLDTEEADLIGADTQGSEFDFTDFTLPSPSQTQASQHDAAQASQQT 60

Query: 57  --IQVNGKQNLDNSNLNL--VSQKLHELQFEEEEDDGNEFFNKELPPHACKYCGIHDPAY 112
             +Q+NG       +L +   +Q L ELQFEEEE++   ++N++LP HACKYCGIH+ + 
Sbjct: 61  QPVQINGTVGTSALDLKISGAAQSLAELQFEEEEEEA--YYNRDLPDHACKYCGIHEASC 118

Query: 113 VIMCNICKKWFCNGRGHTSGSHIINHLVRAKHKEVTLHKDGPLGETVLECYTCGVRNIFV 172
           V+MCN+C+KWFCNGRG+TSGSHIINHLVRAKHKEVTLH+DGPLGET+LECY+C VRN+FV
Sbjct: 119 VVMCNVCRKWFCNGRGNTSGSHIINHLVRAKHKEVTLHRDGPLGETILECYSCAVRNVFV 178

Query: 173 LGFIPAKADSVVVLLCRTPCAAQNSLKDMNWDQEQWKPLIADRSFLSWLVKVPTEQEQQR 232
           LGFIPAKADSVVVLLCR PCAAQ+SLKDMNWDQEQWKPLI DRSFLSWLVK+P+EQEQ R
Sbjct: 179 LGFIPAKADSVVVLLCRQPCAAQSSLKDMNWDQEQWKPLIEDRSFLSWLVKIPSEQEQLR 238

Query: 233 GRQVTSAQIAKLEEVWKDNAEATFQDLEKPGVDEDPHQVLLRYEDGYQYQNIFGPLVKLE 292
            RQ+++ QI KLEE+W+DN +ATFQDLEKPGVDE+P Q                      
Sbjct: 239 ARQISAQQINKLEELWRDNVDATFQDLEKPGVDEEPQQ---------------------- 276

Query: 293 ADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDGYQYQNIFGPLVKLEADYDK 352
                          V +R++                  DGYQYQNIFGPLVKLEADYDK
Sbjct: 277 ---------------VLLRYE------------------DGYQYQNIFGPLVKLEADYDK 303

Query: 353 RLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDMRLMQGDELKLRYSYDASKTWSGLG 412
           RLKESQTQEN+ VRWDVGLNKK+IAYF LAKTDGDM+LM GDEL+LRY  +  K WSG+G
Sbjct: 304 RLKESQTQENIEVRWDVGLNKKTIAYFMLAKTDGDMKLMHGDELRLRYLGELHKPWSGIG 363

Query: 413 HVIKIPDNFGDEVGLELKSSAGAPTEATTGFSVDFIWKSTSFDRMQLALRKFAVDDQSVS 472
           HVIKIPDN+G+EVG+ELK+++GAPTE T+ F VDFIWKSTSFDRMQLALRKFAVDD SVS
Sbjct: 364 HVIKIPDNYGEEVGIELKNNSGAPTECTSNFVVDFIWKSTSFDRMQLALRKFAVDDTSVS 423

Query: 473 AYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGPPGTGK 532
           AYIYHRLLGH V+EVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGPPGTGK
Sbjct: 424 AYIYHRLLGHEVEEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGPPGTGK 483

Query: 533 TVTSATIVYQLVKQTGSPVLVCAPSNIAVDQLTEKIHRTGLKVVRVCAKSREAIDSPVSF 592
           TVTSATIVYQLVKQ G PVLVCAPSN AVDQLTEKIH++ LKVVR+CAKSREAIDSPVSF
Sbjct: 484 TVTSATIVYQLVKQNGGPVLVCAPSNTAVDQLTEKIHKSNLKVVRLCAKSREAIDSPVSF 543

Query: 593 LALHNQIRNMEMNSELKKLLQLKEETGELSSADEKRYRMLKKNAEKSLLDNADVICCTCV 652
           LALHNQI+NME N+EL+KL QLK+ETGELSS DEKRYR+LKK AEK LL+ ADVICCTCV
Sbjct: 544 LALHNQIKNMETNTELQKLQQLKDETGELSSVDEKRYRLLKKAAEKELLEAADVICCTCV 603

Query: 653 GAGDPRLLKIKFHSILIDESMQATEPECMVPVILGAKQLILVGDHCQLGPVVMCKKAARA 712
           GAGDPRL ++KFHSILIDESMQATEPECMVPV+LGAKQLILVGDHCQLGPVVMCKKAARA
Sbjct: 604 GAGDPRLHRLKFHSILIDESMQATEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAARA 663

Query: 713 GLSQSLFERLVVLGIRPFRLEVQYRMHPELSKFPSNFFYEGSLQNGVCADERKLSKIDFP 772
           GLSQSLFERLVVLGIRPFRLEVQYRMHP+LS+FPSNFFYEGSLQNGVCADERKL KIDFP
Sbjct: 664 GLSQSLFERLVVLGIRPFRLEVQYRMHPDLSRFPSNFFYEGSLQNGVCADERKLLKIDFP 723

Query: 773 WPVPDKPMLFYVTQGQEEIAGSGTSYVNRTEASNVEKITTRFIRCGMKPEQIGVITPYEG 832
           WP PDKPM FYVTQGQEEIAGSGTSY+NRTEASNVEKITTRF+RCG+KPEQIGVITPYEG
Sbjct: 724 WPAPDKPMFFYVTQGQEEIAGSGTSYLNRTEASNVEKITTRFLRCGVKPEQIGVITPYEG 783

Query: 833 QRAFLVQHMQYQGSLPAKIYQEIEVASVDAFQGREKDLIIMSCVRSNDHQGIGFLNDPRR 892
           QRA+LVQ+MQYQGSL +K+YQEIEVASVDAFQGREKD+IIMSCVRSN+HQGIGFLNDPRR
Sbjct: 784 QRAYLVQYMQYQGSLHSKLYQEIEVASVDAFQGREKDIIIMSCVRSNEHQGIGFLNDPRR 843

Query: 893 LNVALTRAKYGIIVIGNPKVLSKQPLWNNLLNFYKEQKVLVEGPLNNLKESLILFSKPKQ 952
           LNVALTRAKYGII++GNPKVLSKQPLWN+LL+FYKEQKVLVEGPLNNLKES+I F+KPK+
Sbjct: 844 LNVALTRAKYGIIIVGNPKVLSKQPLWNHLLSFYKEQKVLVEGPLNNLKESMIQFAKPKK 903

Query: 953 YFKKNN 958
                N
Sbjct: 904 LVNAAN 909




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345491348|ref|XP_003426578.1| PREDICTED: regulator of nonsense transcripts 1-like isoform 3 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383847285|ref|XP_003699285.1| PREDICTED: regulator of nonsense transcripts 1-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|340721321|ref|XP_003399071.1| PREDICTED: regulator of nonsense transcripts 1-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|66553048|ref|XP_393330.2| PREDICTED: regulator of nonsense transcripts 1 [Apis mellifera] gi|380015761|ref|XP_003691864.1| PREDICTED: regulator of nonsense transcripts 1-like [Apis florea] Back     alignment and taxonomy information
>gi|350406734|ref|XP_003487865.1| PREDICTED: regulator of nonsense transcripts 1-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|350406741|ref|XP_003487867.1| PREDICTED: regulator of nonsense transcripts 1-like isoform 3 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340721323|ref|XP_003399072.1| PREDICTED: regulator of nonsense transcripts 1-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|345491350|ref|XP_001604124.2| PREDICTED: regulator of nonsense transcripts 1-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350406738|ref|XP_003487866.1| PREDICTED: regulator of nonsense transcripts 1-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query959
FB|FBgn0030354 1180 Upf1 "Upf1" [Drosophila melano 0.653 0.531 0.776 0.0
UNIPROTKB|E1C0J4 1117 UPF1 "Uncharacterized protein" 0.647 0.555 0.763 0.0
ZFIN|ZDB-GENE-040426-2836 1100 upf1 "upf1 regulator of nonsen 0.647 0.564 0.763 0.0
UNIPROTKB|E1BEK9 1127 UPF1 "Uncharacterized protein" 0.647 0.551 0.75 0.0
UNIPROTKB|E2RL81 1130 UPF1 "Uncharacterized protein" 0.647 0.549 0.75 0.0
UNIPROTKB|Q92900 1129 UPF1 "Regulator of nonsense tr 0.647 0.550 0.75 0.0
UNIPROTKB|E1C0J3 1128 UPF1 "Uncharacterized protein" 0.647 0.550 0.75 0.0
MGI|MGI:107995 1124 Upf1 "UPF1 regulator of nonsen 0.647 0.552 0.745 0.0
TAIR|locus:2171007 1254 LBA1 "LOW-LEVEL BETA-AMYLASE 1 0.652 0.499 0.641 0.0
ASPGD|ASPL0000056713 1077 AN0646 [Emericella nidulans (t 0.650 0.579 0.633 2.1e-310
FB|FBgn0030354 Upf1 "Upf1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 2550 (902.7 bits), Expect = 0., Sum P(2) = 0.
 Identities = 491/632 (77%), Positives = 550/632 (87%)

Query:   332 DGYQYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDMRLM 391
             DGYQY+  FGPLV+LEA+YD++LKES TQEN+ VRWDVGLNKK+IAYF+LAKTD DM+LM
Sbjct:   275 DGYQYEKTFGPLVRLEAEYDQKLKESATQENIEVRWDVGLNKKTIAYFTLAKTDSDMKLM 334

Query:   392 QGDELKLRYSYDASKTWSGLGHVIKIPDNFGDEVGLELKSSAGAPTEATTGFSVDFIWKS 451
              GDEL+L Y  +    WS +GHVIK+PDNFGD+VGLELKSS  AP + T+ F+VDFIWK 
Sbjct:   335 HGDELRLHYVGELYNPWSEIGHVIKVPDNFGDDVGLELKSSTNAPVKCTSNFTVDFIWKC 394

Query:   452 TSFDRMQLALRKFAVDDQSVSAYIYHRLLGH----NVDEVLFRCHLPKHFSAPNLPDLNR 507
             TSFDRM  AL KFA+D  SVS +IY RLLGH    + DEVLFR   PK FSAP+LPDLNR
Sbjct:   395 TSFDRMTRALCKFAIDRNSVSNFIYSRLLGHGRADSNDEVLFRGPQPKLFSAPHLPDLNR 454

Query:   508 SQVYAVKHAIQRPLSLIQGPPGTGKTVTSATIVYQLVKQTGSPVLVCAPSNIAVDQLTEK 567
             SQVYAVKHA+QRPLSLIQGPPGTGKTVTSATIVYQLVK  G  VLVCAPSN AVDQLTEK
Sbjct:   455 SQVYAVKHALQRPLSLIQGPPGTGKTVTSATIVYQLVKLHGGTVLVCAPSNTAVDQLTEK 514

Query:   568 IHRTGLKVVRVCAKSREAIDSPVSFLALHNQIRNMEMNSXXXXXXXXXXXXXXXSSADEK 627
             IHRT LKVVRVCAKSREAIDSPVSFLALHNQIRNME NS               SSADEK
Sbjct:   515 IHRTNLKVVRVCAKSREAIDSPVSFLALHNQIRNMETNSELKKLQQLKDETGELSSADEK 574

Query:   628 RYRMLKKNAEKSLLDNADVICCTCVGAGDPRLLKIKFHSILIDESMQATEPECMVPVILG 687
             RYR LK+ AE  LL+ ADVICCTCVGAGD RL ++KF SILIDESMQ+TEPECMVPV+LG
Sbjct:   575 RYRNLKRAAENQLLEAADVICCTCVGAGDGRLSRVKFTSILIDESMQSTEPECMVPVVLG 634

Query:   688 AKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFRLEVQYRMHPELSKFPS 747
             AKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFRLEVQYRMHPELS+FPS
Sbjct:   635 AKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFRLEVQYRMHPELSQFPS 694

Query:   748 NFFYEGSLQNGVCADERKLSKIDFPWPVPDKPMLFYVTQGQEEIAGSGTSYVNRTEASNV 807
             NFFYEGSLQNGVCA++R+L K+DFPWP P++PM F VTQGQEEIAGSGTS++NRTEA+NV
Sbjct:   695 NFFYEGSLQNGVCAEDRRL-KLDFPWPQPERPMFFLVTQGQEEIAGSGTSFLNRTEAANV 753

Query:   808 EKITTRFIRCGMKPEQIGVITPYEGQRAFLVQHMQYQGSLPAKIYQEIEVASVDAFQGRE 867
             EKITTRF++ G+KPEQIG+ITPYEGQRA+LVQ+MQYQGSL +++YQEIE+ASVDAFQGRE
Sbjct:   754 EKITTRFLKAGIKPEQIGIITPYEGQRAYLVQYMQYQGSLHSRLYQEIEIASVDAFQGRE 813

Query:   868 KDLIIMSCVRSNDHQGIGFLNDPRRLNVALTRAKYGIIVIGNPKVLSKQPLWNNLLNFYK 927
             KD+IIMSCVRSN+ QGIGFLNDPRRLNVALTRAK+GII++GNPKVL+KQ LWN+LLNFYK
Sbjct:   814 KDIIIMSCVRSNERQGIGFLNDPRRLNVALTRAKFGIIIVGNPKVLAKQQLWNHLLNFYK 873

Query:   928 EQKVLVEGPLNNLKESLILFSKPKQYFKKNNM 959
             ++KVLVEG LNNLKESLI F KPK+     N+
Sbjct:   874 DRKVLVEGSLNNLKESLIHFQKPKKLVNSMNI 905


GO:0004386 "helicase activity" evidence=ISS
GO:0000184 "nuclear-transcribed mRNA catabolic process, nonsense-mediated decay" evidence=ISS;IMP;NAS
GO:0005737 "cytoplasm" evidence=IEA;NAS
GO:0005524 "ATP binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016246 "RNA interference" evidence=IMP
GO:0035195 "gene silencing by miRNA" evidence=IMP
GO:0071456 "cellular response to hypoxia" evidence=IMP
GO:0035145 "exon-exon junction complex" evidence=IDA
UNIPROTKB|E1C0J4 UPF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2836 upf1 "upf1 regulator of nonsense transcripts homolog (yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BEK9 UPF1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RL81 UPF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q92900 UPF1 "Regulator of nonsense transcripts 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0J3 UPF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:107995 Upf1 "UPF1 regulator of nonsense transcripts homolog (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:2171007 LBA1 "LOW-LEVEL BETA-AMYLASE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000056713 AN0646 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VYS3RENT1_DROME3, ., 6, ., 4, ., -0.71420.93630.7610yesN/A
O76512RENT1_CAEEL3, ., 6, ., 4, ., -0.49370.92700.8316yesN/A
Q9FJR0RENT1_ARATH3, ., 6, ., 4, ., -0.60440.86960.6650yesN/A
P30771NAM7_YEAST3, ., 6, ., 4, ., -0.51940.84460.8341yesN/A
Q92900RENT1_HUMAN3, ., 6, ., 4, ., -0.68270.93530.7945yesN/A
Q54I89RENT1_DICDI3, ., 6, ., 4, ., -0.48350.86750.6250yesN/A
Q09820RENT1_SCHPO3, ., 6, ., 4, ., -0.54390.86440.8962yesN/A
Q98TR3RENT1_TAKRU3, ., 6, ., 4, ., -0.68760.93320.8158N/AN/A
Q9EPU0RENT1_MOUSE3, ., 6, ., 4, ., -0.68310.93530.7980yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.12LOW CONFIDENCE prediction!
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query959
COG1112767 COG1112, COG1112, Superfamily I DNA and RNA helica 1e-100
pfam09416152 pfam09416, UPF1_Zn_bind, RNA helicase (UPF2 intera 2e-92
TIGR00376637 TIGR00376, TIGR00376, DNA helicase, putative 6e-87
pfam13087195 pfam13087, AAA_12, AAA domain 2e-80
pfam13086220 pfam13086, AAA_11, AAA domain 1e-62
pfam1324573 pfam13245, AAA_19, Part of AAA domain 1e-11
TIGR01447586 TIGR01447, recD, exodeoxyribonuclease V, alpha sub 2e-09
pfam13604195 pfam13604, AAA_30, AAA domain 1e-08
pfam04851100 pfam04851, ResIII, Type III restriction enzyme, re 2e-05
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 9e-05
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 1e-04
TIGR01448720 TIGR01448, recD_rel, helicase, putative, RecD/TraA 4e-04
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 0.001
PRK10875615 PRK10875, recD, exonuclease V subunit alpha; Provi 0.002
>gnl|CDD|224037 COG1112, COG1112, Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] Back     alignment and domain information
 Score =  330 bits (848), Expect = e-100
 Identities = 206/826 (24%), Positives = 314/826 (38%), Gaps = 71/826 (8%)

Query: 124 CNGRGHTSGSHIINHLVRAKHKEVTLHKDGPLGETVLECYTCGVRNIFVLGFIPAKADSV 183
            N +        I +   + +          + E++L C     RN F+L     K   V
Sbjct: 1   ENLKFELLIKKKIENEELSSNLNELTLLIV-IKESLLGCVNNLKRNTFLLEITDLKKKWV 59

Query: 184 VVLLCRTPCAAQNSLKDMNWDQEQWKPLIADRSFLSWLVKVPTEQEQQRGRQVTSAQIAK 243
             L+             +  D    + L      LS  +    E EQ+   +    +I K
Sbjct: 60  EALVRLDKLIKSLPSLLLVRDGTLNRELKELIDSLSKKLGKLVEIEQEAEIKTKELEIKK 119

Query: 244 LEEVWKDNAEATFQDLEKPGVDED-PHQVLLRYE-DGYQYQNIFGPLVKLEADYDKRLKE 301
           L    +         L    + E+   + L++Y              V       K  K 
Sbjct: 120 LRLAKRSFKGRAILGLLAKVLGENLGSEALVKYGRLESYIN--LEEFVGELVLVSKLNKI 177

Query: 302 SQTQENVTVRWDVGLNKKSIAYFSLAKTDGDGYQYQNIFGPLVKLEADYDKRLKESQTQE 361
                 + + +   L K                    I  P +  +             E
Sbjct: 178 KSELAGLLIEYLKRLRKVLDK----------------IIPPPLFEK-------------E 208

Query: 362 NVTVRWDVGLNKKSIAYFSLAKTDGDMRLMQGDELKLRYSYDASKTWSGLGHVIKIPDNF 421
            V V     L +             +  L++ +   L       K          +   F
Sbjct: 209 EVRVDIVENLLEL-----------SESILLRRELELLSKFALILK--------RLLESLF 249

Query: 422 GDEVGLELKSSAGAPTEATTGFSVDFI-WKSTSFDRMQLALRKFAVDDQSVSA-YIYHRL 479
               G +L              + +    +  +  R+      F +              
Sbjct: 250 EILRGKDLPIKLLDVELELVEINKELDNEQKLAVKRLLSLNDLFLIHQGPFGTGKTRSVT 309

Query: 480 LGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGPPGTGKTVTSATI 539
           +   + E+L    L    +A +   ++       +  I+  L  I  P    K +   T+
Sbjct: 310 ILELIIELLENNKLKILPTAESNAAVDNLLRRLKRTVIKVELLRIGHPSRVLKKLKLDTL 369

Query: 540 VYQLVKQTGSPVLVCAPSNIAVDQLTEKIHRTGLKVVRVCAKSREAIDSPVSFLALHNQI 599
              L K       + A     +D++  ++   G +++R  AK RE ++        H  +
Sbjct: 370 EELLEKHEIPGNKIAA-----LDKVIRELREEGERIIREIAKLRERLERKRLDKISHLNV 424

Query: 600 RNMEMNSELKKLLQLKEETGELSSADEKRYRMLKKNAEKSLLDNADVICCTCVGAGDPRL 659
               +   L K   L     E      K  R LKK A   +L+ ADV+  T   AG   L
Sbjct: 425 ALRGILPALNKSEALWISLEEKQKKILKELRRLKKKAVTKILEAADVVLSTLSIAGFSIL 484

Query: 660 LKIKFHSILIDESMQATEPECMVPVILGAKQLILVGDHCQLGPVVMCKKAARAGLSQSLF 719
            K +F  ++IDE+ QATEP  ++ +   AK++ILVGDH QL P V  K+++  GLS SLF
Sbjct: 485 KKYEFDYVIIDEASQATEPSALIALSR-AKKVILVGDHKQLPPTVFFKESSPEGLSASLF 543

Query: 720 ERLVVLGIRPFR-LEVQYRMHPELSKFPSNFFYEGSLQNGVCADERKLSKIDFPWPVPDK 778
           ERL+  G      L VQYRMHP++  F S  FY G L+         L   + P  V   
Sbjct: 544 ERLIDNGPEVVYLLRVQYRMHPDIIAFSSKVFYNGRLEVHTSFLAFTLLDGEIPEVVISN 603

Query: 779 PMLFYVTQGQEEIAGSGTSYVNRTEASNVEKITTRFIRCGMKPEQIGVITPYEGQRAFLV 838
           P+ FY T G EE   S  S +N  EA  V+ I    ++ G++   IGVI+PY  Q     
Sbjct: 604 PLEFYDTLGAEEFFES-KSKLNELEAEIVKVIVDELLKDGLEENDIGVISPYRAQ----- 657

Query: 839 QHMQYQGSLPAKIYQEIEVASVDAFQGREKDLIIMSCVRSN-DHQGIGFLNDPRRLNVAL 897
             +     L  +  + +EV +VD FQGREKD+II+S VRSN D   IGFL DPRRLNVAL
Sbjct: 658 --VSLIRRLLNEAGKGVEVGTVDGFQGREKDVIILSLVRSNDDKGEIGFLGDPRRLNVAL 715

Query: 898 TRAKYGIIVIGNPKVLSKQPLWNNLLNFYKEQKVLVEGPLNNLKES 943
           TRAK  +IV+G+   L   PL+  L+N  K + +L E  L +L+ +
Sbjct: 716 TRAKRKLIVVGSSSTLESDPLYKRLINDLKRKGLLAELNLLDLRLT 761


Length = 767

>gnl|CDD|192286 pfam09416, UPF1_Zn_bind, RNA helicase (UPF2 interacting domain) Back     alignment and domain information
>gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative Back     alignment and domain information
>gnl|CDD|221913 pfam13087, AAA_12, AAA domain Back     alignment and domain information
>gnl|CDD|221912 pfam13086, AAA_11, AAA domain Back     alignment and domain information
>gnl|CDD|222005 pfam13245, AAA_19, Part of AAA domain Back     alignment and domain information
>gnl|CDD|233417 TIGR01447, recD, exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>gnl|CDD|222258 pfam13604, AAA_30, AAA domain Back     alignment and domain information
>gnl|CDD|218292 pfam04851, ResIII, Type III restriction enzyme, res subunit Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|233418 TIGR01448, recD_rel, helicase, putative, RecD/TraA family Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|236783 PRK10875, recD, exonuclease V subunit alpha; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 959
KOG1802|consensus935 100.0
TIGR00376637 DNA helicase, putative. The gene product may repre 100.0
KOG1803|consensus649 100.0
PF09416152 UPF1_Zn_bind: RNA helicase (UPF2 interacting domai 100.0
KOG1805|consensus1100 100.0
KOG1807|consensus1025 100.0
COG1112767 Superfamily I DNA and RNA helicases and helicase s 100.0
KOG1804|consensus775 100.0
KOG1801|consensus827 100.0
PF13087200 AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP 100.0
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 99.97
KOG1806|consensus1320 99.97
PRK11054684 helD DNA helicase IV; Provisional 99.95
PRK10875615 recD exonuclease V subunit alpha; Provisional 99.95
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 99.95
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 99.95
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 99.94
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 99.94
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 99.94
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 99.93
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 99.92
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 99.88
PRK13826 1102 Dtr system oriT relaxase; Provisional 99.85
TIGR00609 1087 recB exodeoxyribonuclease V, beta subunit. All pro 99.85
PRK13889 988 conjugal transfer relaxase TraA; Provisional 99.85
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 99.85
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA repl 99.84
PRK13909 910 putative recombination protein RecB; Provisional 99.82
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 99.81
PRK10876 1181 recB exonuclease V subunit beta; Provisional 99.79
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 99.78
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 99.72
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 99.71
COG3973747 Superfamily I DNA and RNA helicases [General funct 99.68
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 99.64
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 99.63
TIGR02784 1141 addA_alphas double-strand break repair helicase Ad 99.58
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 99.53
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 99.51
COG0507696 RecD ATP-dependent exoDNAse (exonuclease V), alpha 99.43
COG3972660 Superfamily I DNA and RNA helicases [General funct 99.36
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 99.35
PF1324576 AAA_19: Part of AAA domain 99.26
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 99.24
PF13361 351 UvrD_C: UvrD-like helicase C-terminal domain; PDB: 99.06
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 98.99
PRK10536262 hypothetical protein; Provisional 98.93
KOG1804|consensus 775 98.82
TIGR02773 1158 addB_Gpos ATP-dependent nuclease subunit B. DNA re 98.78
smart00487201 DEXDc DEAD-like helicases superfamily. 98.77
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 98.61
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 98.43
PHA02558501 uvsW UvsW helicase; Provisional 98.38
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 98.37
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 98.33
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 98.33
PF13538104 UvrD_C_2: UvrD-like helicase C-terminal domain; PD 98.3
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 98.17
PTZ00424401 helicase 45; Provisional 98.14
PRK05580679 primosome assembly protein PriA; Validated 98.13
PRK02362 737 ski2-like helicase; Provisional 98.05
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 98.04
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 98.03
TIGR00643630 recG ATP-dependent DNA helicase RecG. 98.02
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.01
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 97.98
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 97.94
PRK00254 720 ski2-like helicase; Provisional 97.94
PRK01172 674 ski2-like helicase; Provisional 97.92
PF04851184 ResIII: Type III restriction enzyme, res subunit; 97.92
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 97.89
PTZ00110545 helicase; Provisional 97.84
PRK13766 773 Hef nuclease; Provisional 97.83
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 97.8
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 97.78
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 97.78
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, 97.77
PHA02653675 RNA helicase NPH-II; Provisional 97.75
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 97.75
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 97.74
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 97.71
COG1204 766 Superfamily II helicase [General function predicti 97.7
KOG1802|consensus935 97.69
PRK09401 1176 reverse gyrase; Reviewed 97.67
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 97.65
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 97.63
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 97.62
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 97.59
PRK106891147 transcription-repair coupling factor; Provisional 97.58
PRK14974336 cell division protein FtsY; Provisional 97.56
PRK14701 1638 reverse gyrase; Provisional 97.5
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 97.47
TIGR00595505 priA primosomal protein N'. All proteins in this f 97.43
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 97.43
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 97.43
PRK13767 876 ATP-dependent helicase; Provisional 97.43
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 97.39
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 97.39
COG1198730 PriA Primosomal protein N' (replication factor Y) 97.38
smart00489289 DEXDc3 DEAD-like helicases superfamily. 97.36
smart00488289 DEXDc2 DEAD-like helicases superfamily. 97.36
COG4096 875 HsdR Type I site-specific restriction-modification 97.35
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 97.34
KOG0354|consensus 746 97.33
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 97.32
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 97.3
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 97.3
PRK04296190 thymidine kinase; Provisional 97.27
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 97.26
KOG2108|consensus 853 97.26
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 97.21
KOG0952|consensus 1230 97.2
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 97.18
KOG0991|consensus333 97.18
COG1200677 RecG RecG-like helicase [DNA replication, recombin 97.11
COG4098441 comFA Superfamily II DNA/RNA helicase required for 97.1
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 97.09
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 97.09
PF13173128 AAA_14: AAA domain 97.08
TIGR02784 1141 addA_alphas double-strand break repair helicase Ad 97.04
cd01124187 KaiC KaiC is a circadian clock protein primarily f 96.96
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.96
COG2256436 MGS1 ATPase related to the helicase subunit of the 96.93
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 96.87
PRK08181269 transposase; Validated 96.85
PRK00771437 signal recognition particle protein Srp54; Provisi 96.85
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.84
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 96.82
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 96.8
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 96.8
PRK12377248 putative replication protein; Provisional 96.79
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 96.79
PRK04914 956 ATP-dependent helicase HepA; Validated 96.75
PHA03311 828 helicase-primase subunit BBLF4; Provisional 96.75
PRK07952244 DNA replication protein DnaC; Validated 96.74
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 96.73
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 96.69
COG0552340 FtsY Signal recognition particle GTPase [Intracell 96.68
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 96.67
KOG0989|consensus346 96.66
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 96.64
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 96.62
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.58
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 96.56
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 96.53
smart00382148 AAA ATPases associated with a variety of cellular 96.53
PRK06526254 transposase; Provisional 96.51
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 96.5
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 96.49
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 96.48
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 96.44
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 96.43
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 96.38
COG1201 814 Lhr Lhr-like helicases [General function predictio 96.33
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.32
COG4889 1518 Predicted helicase [General function prediction on 96.31
PRK13342413 recombination factor protein RarA; Reviewed 96.3
TIGR00064272 ftsY signal recognition particle-docking protein F 96.29
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 96.27
PRK04195482 replication factor C large subunit; Provisional 96.26
PRK14088440 dnaA chromosomal replication initiation protein; P 96.22
KOG0744|consensus423 96.2
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.2
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 96.18
KOG2108|consensus853 96.17
PHA03333 752 putative ATPase subunit of terminase; Provisional 96.16
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 96.14
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 96.13
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 96.12
KOG0330|consensus476 96.11
PRK05973237 replicative DNA helicase; Provisional 96.11
PF00004132 AAA: ATPase family associated with various cellula 96.1
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 96.08
PRK10416318 signal recognition particle-docking protein FtsY; 96.08
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 96.08
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 96.07
PRK08116268 hypothetical protein; Validated 96.06
PRK10867433 signal recognition particle protein; Provisional 96.05
PRK08084235 DNA replication initiation factor; Provisional 96.04
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.01
PRK14087450 dnaA chromosomal replication initiation protein; P 96.01
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.0
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 95.97
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 95.97
PRK06893229 DNA replication initiation factor; Validated 95.96
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 95.95
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 95.88
PRK09200 790 preprotein translocase subunit SecA; Reviewed 95.86
PRK08533230 flagellar accessory protein FlaH; Reviewed 95.86
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 95.85
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 95.84
PRK09183259 transposase/IS protein; Provisional 95.83
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 95.81
cd03115173 SRP The signal recognition particle (SRP) mediates 95.8
COG1205 851 Distinct helicase family with a unique C-terminal 95.75
TIGR00959428 ffh signal recognition particle protein. This mode 95.74
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.74
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 95.74
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 95.73
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.73
KOG0987|consensus540 95.73
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 95.72
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.72
PRK08903227 DnaA regulatory inactivator Hda; Validated 95.7
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 95.69
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 95.64
PRK08727233 hypothetical protein; Validated 95.63
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.63
PRK13833323 conjugal transfer protein TrbB; Provisional 95.59
PRK13894319 conjugal transfer ATPase TrbB; Provisional 95.58
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 95.56
PRK06067234 flagellar accessory protein FlaH; Validated 95.56
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 95.56
PRK04328249 hypothetical protein; Provisional 95.56
PRK13341 725 recombination factor protein RarA/unknown domain f 95.55
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 95.53
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 95.51
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 95.49
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 95.48
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 95.47
PRK06851367 hypothetical protein; Provisional 95.47
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 95.46
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.43
PLN03025319 replication factor C subunit; Provisional 95.4
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 95.4
TIGR02774 1076 rexB_recomb ATP-dependent nuclease subunit B. DNA 95.39
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.38
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 95.38
PRK06921266 hypothetical protein; Provisional 95.37
PF05729166 NACHT: NACHT domain 95.36
TIGR02928365 orc1/cdc6 family replication initiation protein. M 95.35
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 95.33
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 95.32
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.31
PRK09112351 DNA polymerase III subunit delta'; Validated 95.29
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 95.27
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 95.27
KOG0922|consensus 674 95.27
KOG0743|consensus457 95.23
PRK09694 878 helicase Cas3; Provisional 95.23
PF02689 818 Herpes_Helicase: Helicase; InterPro: IPR003840 Thi 95.2
PRK06835329 DNA replication protein DnaC; Validated 95.2
KOG0338|consensus 691 95.19
PHA03368738 DNA packaging terminase subunit 1; Provisional 95.18
KOG0335|consensus482 95.14
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 95.13
PRK05642234 DNA replication initiation factor; Validated 95.11
TIGR02533486 type_II_gspE general secretory pathway protein E. 95.1
KOG0333|consensus673 95.1
PRK10436462 hypothetical protein; Provisional 95.09
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.09
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 95.05
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 95.02
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 95.01
TIGR02237209 recomb_radB DNA repair and recombination protein R 94.98
PRK05707328 DNA polymerase III subunit delta'; Validated 94.95
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 94.94
KOG0951|consensus 1674 94.91
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 94.9
cd01394218 radB RadB. The archaeal protein radB shares simila 94.87
PRK14873665 primosome assembly protein PriA; Provisional 94.8
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 94.79
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 94.75
PRK00411394 cdc6 cell division control protein 6; Reviewed 94.71
PRK09361225 radB DNA repair and recombination protein RadB; Pr 94.69
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 94.68
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 94.67
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 94.67
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.65
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 94.65
PRK12402337 replication factor C small subunit 2; Reviewed 94.62
TIGR02688449 conserved hypothetical protein TIGR02688. Members 94.58
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 94.53
TIGR02012321 tigrfam_recA protein RecA. This model describes or 94.5
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 94.5
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 94.47
CHL00181287 cbbX CbbX; Provisional 94.46
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 94.36
PHA00729226 NTP-binding motif containing protein 94.33
PRK08939306 primosomal protein DnaI; Reviewed 94.28
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 94.26
KOG2028|consensus554 94.26
PRK09302509 circadian clock protein KaiC; Reviewed 94.26
PRK11823446 DNA repair protein RadA; Provisional 94.25
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 94.22
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 94.22
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 94.19
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 94.16
PRK11331459 5-methylcytosine-specific restriction enzyme subun 94.14
PRK00149450 dnaA chromosomal replication initiation protein; R 94.12
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 94.09
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 94.07
PRK07471365 DNA polymerase III subunit delta'; Validated 94.05
PRK09302509 circadian clock protein KaiC; Reviewed 94.05
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 94.04
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 93.99
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 93.98
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 93.95
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 93.95
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 93.92
PRK08058329 DNA polymerase III subunit delta'; Validated 93.91
cd00983325 recA RecA is a bacterial enzyme which has roles in 93.89
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 93.88
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 93.88
KOG0780|consensus483 93.87
PTZ001121164 origin recognition complex 1 protein; Provisional 93.86
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 93.79
PRK08769319 DNA polymerase III subunit delta'; Validated 93.79
PRK03992389 proteasome-activating nucleotidase; Provisional 93.76
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 93.75
COG4088261 Predicted nucleotide kinase [Nucleotide transport 93.72
PHA02544316 44 clamp loader, small subunit; Provisional 93.7
PRK13531498 regulatory ATPase RavA; Provisional 93.7
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 93.66
PRK12326 764 preprotein translocase subunit SecA; Reviewed 93.66
PRK13768253 GTPase; Provisional 93.58
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 93.58
PRK06851367 hypothetical protein; Provisional 93.57
KOG0342|consensus543 93.55
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 93.54
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 93.53
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 93.53
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 93.5
PF12846304 AAA_10: AAA-like domain 93.49
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 93.49
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 93.49
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 93.47
KOG0781|consensus587 93.47
PF1355562 AAA_29: P-loop containing region of AAA domain 93.46
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 93.46
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 93.39
KOG4284|consensus 980 93.36
PRK06871325 DNA polymerase III subunit delta'; Validated 93.36
TIGR00362405 DnaA chromosomal replication initiator protein Dna 93.35
PHA02533534 17 large terminase protein; Provisional 93.32
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 93.3
PRK07399314 DNA polymerase III subunit delta'; Validated 93.27
KOG0331|consensus519 93.21
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 93.18
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 93.18
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 93.16
PRK08233182 hypothetical protein; Provisional 93.11
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 93.11
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 93.1
KOG0348|consensus708 93.05
PF07726131 AAA_3: ATPase family associated with various cellu 93.01
PRK09354349 recA recombinase A; Provisional 92.99
KOG0923|consensus 902 92.99
PRK00440319 rfc replication factor C small subunit; Reviewed 92.96
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 92.93
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 92.92
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 92.89
PRK08118167 topology modulation protein; Reviewed 92.86
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 92.84
PRK12422445 chromosomal replication initiation protein; Provis 92.84
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 92.82
PRK06620214 hypothetical protein; Validated 92.8
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 92.76
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 92.73
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 92.7
COG1936180 Predicted nucleotide kinase (related to CMP and AM 92.69
KOG3347|consensus176 92.68
KOG0385|consensus 971 92.65
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 92.64
PRK14530215 adenylate kinase; Provisional 92.61
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 92.61
PRK00131175 aroK shikimate kinase; Reviewed 92.58
TIGR00665434 DnaB replicative DNA helicase. This model describe 92.57
cd01393226 recA_like RecA is a bacterial enzyme which has rol 92.54
cd03114148 ArgK-like The function of this protein family is u 92.49
PRK14531183 adenylate kinase; Provisional 92.49
KOG1131|consensus 755 92.48
COG2255332 RuvB Holliday junction resolvasome, helicase subun 92.43
COG4178604 ABC-type uncharacterized transport system, permeas 92.43
PRK06762166 hypothetical protein; Provisional 92.42
PRK03839180 putative kinase; Provisional 92.4
COG11971139 Mfd Transcription-repair coupling factor (superfam 92.39
PTZ00301210 uridine kinase; Provisional 92.39
KOG0920|consensus 924 92.33
KOG0328|consensus400 92.3
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 92.26
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 92.24
PRK05541176 adenylylsulfate kinase; Provisional 92.24
KOG0953|consensus 700 92.16
COG0714329 MoxR-like ATPases [General function prediction onl 92.16
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 92.15
KOG0387|consensus 923 92.14
KOG0390|consensus776 92.13
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 92.13
PRK14532188 adenylate kinase; Provisional 92.1
PHA02244383 ATPase-like protein 92.08
PRK13107 908 preprotein translocase subunit SecA; Reviewed 92.05
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 92.04
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 91.97
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 91.97
PRK09435332 membrane ATPase/protein kinase; Provisional 91.94
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 91.93
COG1618179 Predicted nucleotide kinase [Nucleotide transport 91.93
PRK04040188 adenylate kinase; Provisional 91.91
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 91.88
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 91.86
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 91.85
PRK14527191 adenylate kinase; Provisional 91.81
PRK13764602 ATPase; Provisional 91.77
COG3857 1108 AddB ATP-dependent nuclease, subunit B [DNA replic 91.77
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 91.77
PLN02200234 adenylate kinase family protein 91.77
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 91.76
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 91.74
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 91.74
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 91.74
KOG1533|consensus290 91.72
PRK02496184 adk adenylate kinase; Provisional 91.71
COG0470325 HolB ATPase involved in DNA replication [DNA repli 91.71
KOG1970|consensus634 91.7
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 91.68
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 91.68
cd02034116 CooC The accessory protein CooC, which contains a 91.67
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 91.66
KOG0733|consensus 802 91.66
PRK14528186 adenylate kinase; Provisional 91.63
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 91.6
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 91.6
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 91.58
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 91.56
PRK12608380 transcription termination factor Rho; Provisional 91.54
KOG0731|consensus774 91.53
PRK05480209 uridine/cytidine kinase; Provisional 91.53
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 91.51
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 91.48
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 91.48
PRK07261171 topology modulation protein; Provisional 91.4
PRK06964342 DNA polymerase III subunit delta'; Validated 91.4
KOG0651|consensus388 91.39
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 91.39
PRK07667193 uridine kinase; Provisional 91.39
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 91.37
CHL00195489 ycf46 Ycf46; Provisional 91.36
PRK00889175 adenylylsulfate kinase; Provisional 91.33
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 91.3
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 91.27
PRK00279215 adk adenylate kinase; Reviewed 91.25
PRK12904 830 preprotein translocase subunit SecA; Reviewed 91.22
KOG0727|consensus408 91.2
PRK06696223 uridine kinase; Validated 91.17
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 91.17
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 91.12
PHA00547337 hypothetical protein 91.02
KOG0926|consensus 1172 91.01
cd03112158 CobW_like The function of this protein family is u 90.99
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 90.93
KOG0738|consensus491 90.85
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 90.85
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 90.81
PRK05439311 pantothenate kinase; Provisional 90.8
PRK13851344 type IV secretion system protein VirB11; Provision 90.78
PRK08154309 anaerobic benzoate catabolism transcriptional regu 90.78
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 90.78
PRK04301317 radA DNA repair and recombination protein RadA; Va 90.75
PRK13407334 bchI magnesium chelatase subunit I; Provisional 90.71
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). 90.71
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 90.67
KOG0343|consensus 758 90.64
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 90.64
cd02117212 NifH_like This family contains the NifH (iron prot 90.6
PTZ00202550 tuzin; Provisional 90.58
PRK06547172 hypothetical protein; Provisional 90.57
COG1202 830 Superfamily II helicase, archaea-specific [General 90.54
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 90.54
PRK13947171 shikimate kinase; Provisional 90.54
cd03116159 MobB Molybdenum is an essential trace element in t 90.5
COG3911183 Predicted ATPase [General function prediction only 90.46
PRK08760476 replicative DNA helicase; Provisional 90.41
PRK05298 652 excinuclease ABC subunit B; Provisional 90.4
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 90.36
KOG1942|consensus456 90.3
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 90.29
TIGR02236310 recomb_radA DNA repair and recombination protein R 90.26
PRK05595444 replicative DNA helicase; Provisional 90.2
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 90.14
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 90.13
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 90.13
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 90.11
PRK09087226 hypothetical protein; Validated 90.11
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 90.1
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 90.03
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 90.01
PRK14494229 putative molybdopterin-guanine dinucleotide biosyn 90.0
KOG0389|consensus 941 89.98
PRK05748448 replicative DNA helicase; Provisional 89.97
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 89.96
PHA02624647 large T antigen; Provisional 89.96
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 89.95
PTZ00088229 adenylate kinase 1; Provisional 89.91
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 89.9
PF13479213 AAA_24: AAA domain 89.66
KOG0344|consensus593 89.64
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 89.64
PHA02530300 pseT polynucleotide kinase; Provisional 89.62
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 89.6
>KOG1802|consensus Back     alignment and domain information
Probab=100.00  E-value=4.6e-232  Score=1917.72  Aligned_cols=860  Identities=68%  Similarity=1.132  Sum_probs=828.7

Q ss_pred             CCCCCCccccCCccccCCCccccccccchhhhhhcCCCCCCCchhhhhhhcccccccccccccCccccccCCCccccCcc
Q psy3251          26 GDTQGSEFDFTDFTLPSQSQTQASQLDSVNQIQVNGKQNLDNSNLNLVSQKLHELQFEEEEDDGNEFFNKELPPHACKYC  105 (959)
Q Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~yc  105 (959)
                      ++||+++|||.||..|.++| ++.++.....              ..+...++++.|||-..+.+-.....+|+|+|+||
T Consensus         2 ~n~~ds~~e~~~~~~~~~~~-~~~~L~~g~~--------------~~v~d~~~e~~fee~~~~~~~~~~~~~~~~~c~Yc   66 (935)
T KOG1802|consen    2 GNTQDSEFEYCQFPSPTQSQ-PATDLSSGVG--------------GKVDDSVGEVLFEECLVEKNRAREQKLPEHACAYC   66 (935)
T ss_pred             CCCCCCcceeccCCccccCC-CCcccccccc--------------cccccccchhhhhhhccccccccccccchhhhhhc
Confidence            78999999999997777774 3333333111              12233378999998555544455669999999999


Q ss_pred             CCCCCCceeecCccCceeecCCCCCCcchhhHHHHHcCCCeeeecCCCCCCcceeEeeccCCcceeeeeceeccCCcEEE
Q psy3251         106 GIHDPAYVIMCNICKKWFCNGRGHTSGSHIINHLVRAKHKEVTLHKDGPLGETVLECYTCGVRNIFVLGFIPAKADSVVV  185 (959)
Q Consensus       106 ~~~~~~~~~~c~~~~~wfcn~~~~~~~shi~~hlv~~~~~~~~lh~~~~~~~~~~ec~~c~~~n~f~lgf~~~~~~~~~~  185 (959)
                      ||++|.||++|++|+|||||||++|+|||||+||||++||+|+||+|+|+|||+||||+||++|||+|||+|+|+|+|||
T Consensus        67 gi~~p~~v~kc~~c~Kwfcn~r~gtsgshIv~hlvra~hk~v~lh~ds~lget~lecyncg~~nvf~lGFi~~ksd~VVv  146 (935)
T KOG1802|consen   67 GISEPACVIKCNTCGKWFCNSRGGTSGSHIVNHLVRAKHKEVSLHKDSPLGETVLECYNCGSRNVFLLGFIPAKSDSVVV  146 (935)
T ss_pred             cCCCchheeeccccCceeecCCCCCchhHHHHHHHHhhhheeEeccCCCCCcceEEeeccCcchhhhhcccccccCceEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeCCcccccccccccCCCCCCccccccccccccccccCCCHHHhhhccCCCHHHHHHHHHHHhhCcccccccccCCCCC
Q psy3251         186 LLCRTPCAAQNSLKDMNWDQEQWKPLIADRSFLSWLVKVPTEQEQQRGRQVTSAQIAKLEEVWKDNAEATFQDLEKPGVD  265 (959)
Q Consensus       186 ~~cr~~c~~~~~~~~~~~d~~~w~pli~~~~~~~~~~~~p~~~~~~~~~~~~~~~i~~le~~w~~~~~~~~~~~~~~~~~  265 (959)
                      |+||+||++.+.+||||||.+||+|||+|||||+||+++|+++|+.+||+||++||++|||+||+||+||++||++|+.+
T Consensus       147 llcr~pcas~s~~kd~Nwd~~qw~~li~dr~~l~wivk~pseqe~~~aR~iT~qqi~~~eelwr~np~at~~dl~kP~~d  226 (935)
T KOG1802|consen  147 LLCRQPCASRSNLKDMNWDLSQWQPLIEDRCLLSWIVKVPSEQEQLRARKITAQQIVKLEELWRKNPSATLEDLDKPGED  226 (935)
T ss_pred             EEecCcccccccCCCcCCChhhccchhhhhcccchhccCCcchhhhhhccccHHHHHHHHhhhccCCccchhhcCCcccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccccccccCChHHHHHhhhhHHHhhhHHHHHHhhhccccceEEEEeccCCceeEEEEEccccCCCccccccccchhhh
Q psy3251         266 EDPHQVLLRYEDGYQYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDGYQYQNIFGPLVK  345 (959)
Q Consensus       266 ~~~~~~~~~y~~~~~y~~~f~~lv~~e~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~Y~~~f~pLi~  345 (959)
                      +++++|++||+|||+||++|+|||+|||||||++||||++++++|||++|||+|++|||.+++.+.              
T Consensus       227 ~~~~hv~~ry~da~~y~~vf~pliklea~ydk~~Kes~~q~~~tvRW~~gLnkk~~a~f~~~k~~~--------------  292 (935)
T KOG1802|consen  227 EEPPHVQLRYEDAYEYQNVFSPLIKLEADYDKRLKESQTQENGTVRWDIGLNKKRLAYFTLPKLDS--------------  292 (935)
T ss_pred             cCCCcccccccchHHHhhhcchhhhhhhhhhhhhhhhcccccceEEeeeccccceEEEEecCCCcc--------------
Confidence            999999999999999999999999999999999999999999999999999999999999998844              


Q ss_pred             hhhhhhhhhhhcccccceeeeeecccccceeeEeeecccCCCCCCCCCCEEEEEEccCCCCcceeEEEEEecCCCCCCeE
Q psy3251         346 LEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDMRLMQGDELKLRYSYDASKTWSGLGHVIKIPDNFGDEV  425 (959)
Q Consensus       346 lea~~~~~~kes~~~~nvtvr~~~~~~~k~~~~f~~~~~~~~~~l~~GD~v~l~~~~~~~~~~~~~g~v~~~~~~~~~ev  425 (959)
                                                               +++++.||+++|+|+|....+|+++|+|+++|+++++|+
T Consensus       293 -----------------------------------------e~kl~~GdE~~L~y~~~~~~~w~~~g~v~~~pd~~~dE~  331 (935)
T KOG1802|consen  293 -----------------------------------------ELKLAIGDEIRLTYSGGLVLPWNGIGSVLKIPDNNGDEV  331 (935)
T ss_pred             -----------------------------------------hhccccCCeeEEEecCCcCCcccccceEEecCCCCccee
Confidence                                                     899999999999999999888999999999999999999


Q ss_pred             EEEeccCCCCCCCCCcceEEEEeeCccHHHHHHHHHHHHHHhhhhhHHHHHHHhcCCCcchhhcccCCCCCCCCCCCCCC
Q psy3251         426 GLELKSSAGAPTEATTGFSVDFIWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDL  505 (959)
Q Consensus       426 ~l~l~~~~~~p~~~~~~~~v~~~~~~~~~~R~~~aL~~~~~~~~~~~~~i~~~llg~~~~~~~~~~~~p~~~~~~~~~~L  505 (959)
                      .||++...+.|.+.++.|+|+|+|++++|+||+.||+.|+.|+++++.|+|+.++||+.++..+...+|+.|+.|+++.|
T Consensus       332 ~lEl~~~~~~p~e~~~~Ftvd~vwk~ts~drm~~alk~la~D~~~vs~y~y~klLgh~~~~~~~k~~LP~~~s~~~lpkL  411 (935)
T KOG1802|consen  332 KLELEFSQDPPIEVTHGFTVDFVWKSTSFDRMQLALKLLAVDEKKVSGYLYHKLLGHPVEDSSLKKLLPRRFSVPNLPKL  411 (935)
T ss_pred             EEEeecCCCCCcccccceEEEEEEcCccHHHHHHHHHHhhhccccchhhhhhHHhcCcchhhhhcccCchhhcCCCchhh
Confidence            99999999999999999999999999999999999999999999999999999999999888888899999999999999


Q ss_pred             CHHHHHHHHHHhcCCcEEEEcCCCChHHHHHHHHHHHHHHccCCCEEEEcccHHHHHHHHHHHHhcCCeEEEeecccccc
Q psy3251         506 NRSQVYAVKHAIQRPLSLIQGPPGTGKTVTSATIVYQLVKQTGSPVLVCAPSNIAVDQLTEKIHRTGLKVVRVCAKSREA  585 (959)
Q Consensus       506 N~sQ~~AV~~al~~~l~LIqGPPGTGKT~Tia~ii~~Ll~~~~~rILV~ApSN~AvD~L~erL~~~gl~vvRl~~~sre~  585 (959)
                      |.||..||+++|++|++|||||||||||.|+++||++|+++...+||||||||.|||+|+++|+++|++|+|+++++||.
T Consensus       412 N~SQ~~AV~~VL~rplsLIQGPPGTGKTvtsa~IVyhl~~~~~~~VLvcApSNiAVDqLaeKIh~tgLKVvRl~aksRE~  491 (935)
T KOG1802|consen  412 NASQSNAVKHVLQRPLSLIQGPPGTGKTVTSATIVYHLARQHAGPVLVCAPSNIAVDQLAEKIHKTGLKVVRLCAKSRED  491 (935)
T ss_pred             chHHHHHHHHHHcCCceeeecCCCCCceehhHHHHHHHHHhcCCceEEEcccchhHHHHHHHHHhcCceEeeeehhhhhh
Confidence            99999999999999999999999999999999999999999899999999999999999999999999999999999999


Q ss_pred             cCCchhHHHHHHHHHhhhhhHHHHHHHHHHHHhccCChHHHHHHHHHHHHHHHHhhccCceeeeeccccCCcccccCCcC
Q psy3251         586 IDSPVSFLALHNQIRNMEMNSELKKLLQLKEETGELSSADEKRYRMLKKNAEKSLLDNADVICCTCVGAGDPRLLKIKFH  665 (959)
Q Consensus       586 i~~~~~~l~l~~~i~~~~~~~~l~kl~~lk~~~~~ls~~~~k~~~~l~~~~e~~lL~~a~VI~~T~~~a~~~~l~~~~fd  665 (959)
                      +.++++++++|.+++.+.. ++++++.+++++.++++..++++|+.+++..+++++.+|+||||||++||+.+|..++|.
T Consensus       492 ~~S~vs~L~lh~~~~~~~~-pELq~l~klkde~gelS~sD~~k~~~lk~~~e~ell~~AdVIccTcv~Agd~rl~~~kfr  570 (935)
T KOG1802|consen  492 IESDVSFLSLHEQLRNMDK-PELQKLLKLKDEGGELSSSDEKKYRKLKRAAEKELLNQADVICCTCVGAGDRRLSKFKFR  570 (935)
T ss_pred             ccCCccHHHHHHHHhccCc-HHHHHHHhhhhhcccccchhhHHHHHHHHHHHHHHHhhcCEEEEecccccchhhcccccc
Confidence            9999999999999999877 999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEECCCCCChhhhHhhhhhcCCeEEEEccCCCCCceeechhHHhhcCcHHHHHHHHHcCCccEEeccccCCchhHhhh
Q psy3251         666 SILIDESMQATEPECMVPVILGAKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFRLEVQYRMHPELSKF  745 (959)
Q Consensus       666 ~VIIDEAsQ~~Epe~Lipl~~~~krvVLVGD~~QL~Pvv~s~~a~~~gl~~SLFeRL~~~g~~~~~L~~qYRmhp~I~~f  745 (959)
                      .||||||+|++||++|||+++|++++||||||+||+|++++++++.+||.+||||||+..|..|++|.+||||||.|++|
T Consensus       571 ~VLiDEaTQatEpe~LiPlvlG~kq~VlVGDh~QLgpvi~~kK~a~Agl~qsLferli~lg~~P~~L~vQYRmhP~lSef  650 (935)
T KOG1802|consen  571 TVLIDEATQATEPECLIPLVLGAKQLVLVGDHKQLGPVIMCKKAATAGLSQSLFERLISLGIKPIRLQVQYRMHPALSEF  650 (935)
T ss_pred             EEEEecccccCCcchhhhhhhcceeEEEeccccccCceeeeHHHHHhHHHHHHHHHHHhccCCceEEEEeeeeChhhhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhccCCcccccccccccccCCCCCCCCCCCCeEEEEcCCcceeccCCCcccCHHHHHHHHHHHHHHHHcCCCCCcEE
Q psy3251         746 PSNFFYEGSLQNGVCADERKLSKIDFPWPVPDKPMLFYVTQGQEEIAGSGTSYVNRTEASNVEKITTRFIRCGMKPEQIG  825 (959)
Q Consensus       746 ~s~~fY~g~L~~~~~~~~r~~~~~~~~~p~~~~p~~f~~~~g~ee~~~~g~S~~N~~EA~~V~~iv~~Ll~~g~~~~~Ig  825 (959)
                      ||++||+|.|++|++..+|...++++|||.++.|++|+...|.|+++.+|+||.|+.||..++++++.|++.|+.+++||
T Consensus       651 psn~fY~G~LqnGVT~~~R~~~g~~~pwp~p~~pl~fy~~~g~eeisasGtSf~Nr~Ea~~~ekii~~l~~~gv~~~qIG  730 (935)
T KOG1802|consen  651 PSNMFYEGELQNGVTEIERSPLGVDFPWPQPDKPLFFYVCYGQEEISASGTSFLNRTEAANCEKIITKLLKSGVKPSQIG  730 (935)
T ss_pred             chhhhccchhhcCcchhhhccCCCCCCCCCCCCccceEEeccceeeeccccceecHHHHHHHHHHHHHHHHcCCCHHHee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEccChHHHHHHHHHHHhcCCCCcccCCceEEeecccCCCccccEEEEEccccCCCCCccCCCCcCceeecchhhcccEE
Q psy3251         826 VITPYEGQRAFLVQHMQYQGSLPAKIYQEIEVASVDAFQGREKDLIIMSCVRSNDHQGIGFLNDPRRLNVALTRAKYGII  905 (959)
Q Consensus       826 IITPY~~Q~~~L~~~L~~~~~~~~~~~~~V~V~TVd~fQG~E~DiVIlS~Vrsn~~~~iGFl~d~rRLNVAlTRAK~~Li  905 (959)
                      |||||.+|+.+|.++|+..|.++..++..|+|+|||+|||+|+|+||+||||+|...+|||++|+|||||||||||+||+
T Consensus       731 VITpYegQr~~i~~ym~~~gsl~~~ly~~veVasVDaFQGrEKdfIIlSCVRsn~~qgIGFl~d~RRlNVaLTRaK~glv  810 (935)
T KOG1802|consen  731 VITPYEGQRSYIVNYMQTNGSLHKDLYKEVEVASVDAFQGREKDFIILSCVRSNEHQGIGFLNDPRRLNVALTRAKYGLV  810 (935)
T ss_pred             eecccchhHHHHHHHHHhcCccccchhheeEEEeeccccCcccceEEEEEeecccccccccccCchhhhhhhhhcccceE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEccccccCCchHHHHHHHHHHcCceeeccCcchhhhcccCCCCcccccc
Q psy3251         906 VIGNPKVLSKQPLWNNLLNFYKEQKVLVEGPLNNLKESLILFSKPKQYFKK  956 (959)
Q Consensus       906 IvGn~~~L~~~~~W~~ll~~~~~~~~~v~g~~~~l~~~~~~~~~p~~~~~~  956 (959)
                      ||||+.+|+++++|.+||.|+++++++++|++++|++++++|.+|++..+-
T Consensus       811 ivGN~~~L~k~~LW~~li~h~~eke~l~eg~ln~l~~~~~~l~kp~~~~~~  861 (935)
T KOG1802|consen  811 IVGNPKVLRKHPLWGHLITHYKEKEVLVEGPLNNLKPSLLQLLKPQKLKNF  861 (935)
T ss_pred             EecCHHHhhhchHHHHHHHHhhcccceeecchhhhhhhhhhhcCCchhhhh
Confidence            999999999999999999999999999999999999999999999977653



>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PF09416 UPF1_Zn_bind: RNA helicase (UPF2 interacting domain); InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>KOG1807|consensus Back     alignment and domain information
>COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1804|consensus Back     alignment and domain information
>KOG1801|consensus Back     alignment and domain information
>PF13087 AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A 2XZL_A Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG1806|consensus Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>TIGR00609 recB exodeoxyribonuclease V, beta subunit Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13909 putative recombination protein RecB; Provisional Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10876 recB exonuclease V subunit beta; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PF13361 UvrD_C: UvrD-like helicase C-terminal domain; PDB: 1UAA_B 3U4Q_A 3U44_A 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG1804|consensus Back     alignment and domain information
>TIGR02773 addB_Gpos ATP-dependent nuclease subunit B Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PF13538 UvrD_C_2: UvrD-like helicase C-terminal domain; PDB: 1W36_G 3K70_G 3DMN_A 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG2108|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PHA03311 helicase-primase subunit BBLF4; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG2108|consensus Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG0987|consensus Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR02774 rexB_recomb ATP-dependent nuclease subunit B Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PF02689 Herpes_Helicase: Helicase; InterPro: IPR003840 This entry consists of DNA helicases from a number of different organisms Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0780|consensus Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0781|consensus Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>COG3857 AddB ATP-dependent nuclease, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>KOG1533|consensus Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1970|consensus Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PHA00547 hypothetical protein Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>COG3911 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query959
2wjv_A800 Crystal Structure Of The Complex Between Human Nons 0.0
2xzo_A623 Upf1 Helicase - Rna Complex Length = 623 0.0
2gjk_A624 Structural And Functional Insights Into The Human U 0.0
2xzl_A802 Upf1-Rna Complex Length = 802 0.0
2iyk_A162 Crystal Structure Of The Upf2-Interacting Domain Of 9e-74
4b3g_A646 Crystal Structure Of Ighmbp2 Helicase In Complex Wi 4e-48
4b3f_X646 Crystal Structure Of 1ghmbp2 Helicase Length = 646 4e-48
>pdb|2WJV|A Chain A, Crystal Structure Of The Complex Between Human Nonsense Mediated Decay Factors Upf1 And Upf2 Length = 800 Back     alignment and structure

Iteration: 1

Score = 1285 bits (3324), Expect = 0.0, Method: Compositional matrix adjust. Identities = 608/852 (71%), Positives = 690/852 (80%), Gaps = 55/852 (6%) Query: 97 LPPHACKYCGIHDPAYVIMCNICKKWFCNGRGHTSGSHIINHLVRAKHKEVTLHKDGPLG 156 LP HAC YCGIHDPA V+ CN KKWFCNGRG+TSGSHI+NHLVRAK KEVTLHKDGPLG Sbjct: 4 LPIHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGPLG 63 Query: 157 ETVLECYTCGVRNIFVLGFIPAKADSVVVLLCRTPCAAQNSLKDMNWDQEQWKPLIADRS 216 ETVLECY CG RN+F+LGFIPAKADSVVVLLCR PCA+Q+SLKD+NWD QW+PLI DR Sbjct: 64 ETVLECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQDRC 123 Query: 217 FLSWLVKVPTEQEQQRGRQVTSAQIAKLEEVWKDNAEATFQDLEKPGVDEDPHQVLLRYE 276 FLSWLVK+P+EQEQ R RQ+T+ QI KLEE+WK+N AT +DLEKPGVDE+P Sbjct: 124 FLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLEDLEKPGVDEEP-------- 175 Query: 277 DGYQYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDGYQY 336 ++V +R++ D YQY Sbjct: 176 -----------------------------QHVLLRYE------------------DAYQY 188 Query: 337 QNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDMRLMQGDEL 396 QNIFGPLVKLEADYDK+LKESQTQ+N+TVRWD+GLNKK IAYF+L KTD DMRLMQGDE+ Sbjct: 189 QNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTDSDMRLMQGDEI 248 Query: 397 KLRYSYDASKTWSGLGHVIKIPDNFGDEVGLELKSSAGAPTEATTGFSVDFIWKSTSFDR 456 LRY D + W G+GHVIK+PDN+GDE+ +EL+SS GAP E T F VDF+WKSTSFDR Sbjct: 249 CLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFVWKSTSFDR 308 Query: 457 MQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHA 516 MQ AL+ FAVD+ SVS YIYH+LLGH V++V+ +C LPK F+A LPDLN SQVYAVK Sbjct: 309 MQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTV 368 Query: 517 IQRPLSLIQGPPGTGKTVTSATIVYQLVKQTGSPVLVCAPSNIAVDQLTEKIHRTGLKVV 576 +QRPLSLIQGPPGTGKTVTSATIVY L +Q PVLVCAPSNIAVDQLTEKIH+TGLKVV Sbjct: 369 LQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVV 428 Query: 577 RVCAKSREAIDSPVSFLALHNQIRNMEMNSXXXXXXXXXXXXXXXSSADEKRYRMLKKNA 636 R+CAKSREAIDSPVSFLALHNQIRNM+ SSADEKRYR LK+ A Sbjct: 429 RLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSADEKRYRALKRTA 488 Query: 637 EKSLLDNADVICCTCVGAGDPRLLKIKFHSILIDESMQATEPECMVPVILGAKQLILVGD 696 E+ LL NADVICCTCVGAGDPRL K++F SILIDES QATEPECMVPV+LGAKQLILVGD Sbjct: 489 ERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLGAKQLILVGD 548 Query: 697 HCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFRLEVQYRMHPELSKFPSNFFYEGSLQ 756 HCQLGPVVMCKKAA+AGLSQSLFERLVVLGIRP RL+VQYRMHP LS FPSN FYEGSLQ Sbjct: 549 HCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQVQYRMHPALSAFPSNIFYEGSLQ 608 Query: 757 NGVCADERKLSKIDFPWPVPDKPMLFYVTQGQEEIAGSGTSYVNRTEASNVEKITTRFIR 816 NGV A +R DF WP PDKPM FYVTQGQEEIA SGTSY+NRTEA+NVEKITT+ ++ Sbjct: 609 NGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKLLK 668 Query: 817 CGMKPEQIGVITPYEGQRAFLVQHMQYQGSLPAKIYQEIEVASVDAFQGREKDLIIMSCV 876 G KP+QIG+ITPYEGQR++LVQ+MQ+ GSL K+YQE+E+ASVDAFQGREKD II+SCV Sbjct: 669 AGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCV 728 Query: 877 RSNDHQGIGFLNDPRRLNVALTRAKYGIIVIGNPKVLSKQPLWNNLLNFYKEQKVLVEGP 936 R+N+HQGIGFLNDPRRLNVALTRA+YG+I++GNPK LSKQPLWN+LLN+YKEQKVLVEGP Sbjct: 729 RANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVEGP 788 Query: 937 LNNLKESLILFS 948 LNNL+ESL+ FS Sbjct: 789 LNNLRESLMQFS 800
>pdb|2XZO|A Chain A, Upf1 Helicase - Rna Complex Length = 623 Back     alignment and structure
>pdb|2GJK|A Chain A, Structural And Functional Insights Into The Human Upf1 Helicase Core Length = 624 Back     alignment and structure
>pdb|2XZL|A Chain A, Upf1-Rna Complex Length = 802 Back     alignment and structure
>pdb|2IYK|A Chain A, Crystal Structure Of The Upf2-Interacting Domain Of Nonsense Mediated Mrna Decay Factor Upf1 Length = 162 Back     alignment and structure
>pdb|4B3G|A Chain A, Crystal Structure Of Ighmbp2 Helicase In Complex With Rna Length = 646 Back     alignment and structure
>pdb|4B3F|X Chain X, Crystal Structure Of 1ghmbp2 Helicase Length = 646 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query959
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 0.0
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 0.0
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 0.0
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 3e-12
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 5e-10
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 7e-05
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 2e-09
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 4e-04
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 5e-04
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 7e-04
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 Back     alignment and structure
 Score = 1120 bits (2898), Expect = 0.0
 Identities = 621/854 (72%), Positives = 704/854 (82%), Gaps = 55/854 (6%)

Query: 95  KELPPHACKYCGIHDPAYVIMCNICKKWFCNGRGHTSGSHIINHLVRAKHKEVTLHKDGP 154
           K+LP HAC YCGIHDPA V+ CN  KKWFCNGRG+TSGSHI+NHLVRAK KEVTLHKDGP
Sbjct: 2   KDLPIHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGP 61

Query: 155 LGETVLECYTCGVRNIFVLGFIPAKADSVVVLLCRTPCAAQNSLKDMNWDQEQWKPLIAD 214
           LGETVLECY CG RN+F+LGFIPAKADSVVVLLCR PCA+Q+SLKD+NWD  QW+PLI D
Sbjct: 62  LGETVLECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQD 121

Query: 215 RSFLSWLVKVPTEQEQQRGRQVTSAQIAKLEEVWKDNAEATFQDLEKPGVDEDPHQVLLR 274
           R FLSWLVK+P+EQEQ R RQ+T+ QI KLEE+WK+N  AT +DLEKPGVDE+P      
Sbjct: 122 RCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLEDLEKPGVDEEPQH---- 177

Query: 275 YEDGYQYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDGY 334
                                            V +R++                  D Y
Sbjct: 178 ---------------------------------VLLRYE------------------DAY 186

Query: 335 QYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDMRLMQGD 394
           QYQNIFGPLVKLEADYDK+LKESQTQ+N+TVRWD+GLNKK IAYF+L KTD DMRLMQGD
Sbjct: 187 QYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTDSDMRLMQGD 246

Query: 395 ELKLRYSYDASKTWSGLGHVIKIPDNFGDEVGLELKSSAGAPTEATTGFSVDFIWKSTSF 454
           E+ LRY  D +  W G+GHVIK+PDN+GDE+ +EL+SS GAP E T  F VDF+WKSTSF
Sbjct: 247 EICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFVWKSTSF 306

Query: 455 DRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVK 514
           DRMQ AL+ FAVD+ SVS YIYH+LLGH V++V+ +C LPK F+A  LPDLN SQVYAVK
Sbjct: 307 DRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVK 366

Query: 515 HAIQRPLSLIQGPPGTGKTVTSATIVYQLVKQTGSPVLVCAPSNIAVDQLTEKIHRTGLK 574
             +QRPLSLIQGPPGTGKTVTSATIVY L +Q   PVLVCAPSNIAVDQLTEKIH+TGLK
Sbjct: 367 TVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLK 426

Query: 575 VVRVCAKSREAIDSPVSFLALHNQIRNMEMNSELKKLLQLKEETGELSSADEKRYRMLKK 634
           VVR+CAKSREAIDSPVSFLALHNQIRNM+   EL+KL QLK+ETGELSSADEKRYR LK+
Sbjct: 427 VVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSADEKRYRALKR 486

Query: 635 NAEKSLLDNADVICCTCVGAGDPRLLKIKFHSILIDESMQATEPECMVPVILGAKQLILV 694
            AE+ LL NADVICCTCVGAGDPRL K++F SILIDES QATEPECMVPV+LGAKQLILV
Sbjct: 487 TAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLGAKQLILV 546

Query: 695 GDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFRLEVQYRMHPELSKFPSNFFYEGS 754
           GDHCQLGPVVMCKKAA+AGLSQSLFERLVVLGIRP RL+VQYRMHP LS FPSN FYEGS
Sbjct: 547 GDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQVQYRMHPALSAFPSNIFYEGS 606

Query: 755 LQNGVCADERKLSKIDFPWPVPDKPMLFYVTQGQEEIAGSGTSYVNRTEASNVEKITTRF 814
           LQNGV A +R     DF WP PDKPM FYVTQGQEEIA SGTSY+NRTEA+NVEKITT+ 
Sbjct: 607 LQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKL 666

Query: 815 IRCGMKPEQIGVITPYEGQRAFLVQHMQYQGSLPAKIYQEIEVASVDAFQGREKDLIIMS 874
           ++ G KP+QIG+ITPYEGQR++LVQ+MQ+ GSL  K+YQE+E+ASVDAFQGREKD II+S
Sbjct: 667 LKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILS 726

Query: 875 CVRSNDHQGIGFLNDPRRLNVALTRAKYGIIVIGNPKVLSKQPLWNNLLNFYKEQKVLVE 934
           CVR+N+HQGIGFLNDPRRLNVALTRA+YG+I++GNPK LSKQPLWN+LLN+YKEQKVLVE
Sbjct: 727 CVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVE 786

Query: 935 GPLNNLKESLILFS 948
           GPLNNL+ESL+ FS
Sbjct: 787 GPLNNLRESLMQFS 800


>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Length = 608 Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Length = 574 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Length = 446 Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Length = 446 Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Length = 459 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query959
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 100.0
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 100.0
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 100.0
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 100.0
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 99.97
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 99.96
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 99.95
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 99.95
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 99.94
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 99.94
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 99.87
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 99.85
1w36_B 1180 RECB, exodeoxyribonuclease V beta chain; recombina 99.75
3dmn_A174 Putative DNA helicase; APC89291.2, lactobacillus p 99.54
3u4q_B 1166 ATP-dependent helicase/deoxyribonuclease subunit; 99.32
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 98.74
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 98.71
3b6e_A216 Interferon-induced helicase C domain-containing P; 98.69
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 98.67
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 98.61
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 98.59
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 98.58
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 98.57
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 98.56
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 98.55
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 98.53
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 98.51
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 98.5
3bor_A237 Human initiation factor 4A-II; translation initiat 98.49
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 98.49
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 98.48
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 98.47
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 98.47
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 98.44
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 98.43
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 98.42
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 98.39
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 98.39
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 98.37
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 98.37
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 98.36
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 98.34
3h1t_A590 Type I site-specific restriction-modification syst 98.34
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 98.3
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 98.29
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 98.27
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 98.27
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 98.26
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 98.22
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 98.17
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 98.16
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 98.15
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 98.14
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 98.1
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.1
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 98.1
4gl2_A 699 Interferon-induced helicase C domain-containing P; 98.08
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 98.08
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 98.07
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 98.04
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 98.04
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 98.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 97.97
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 97.97
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 97.95
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 97.93
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 97.93
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 97.92
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 97.91
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 97.84
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 97.78
2l8b_A189 Protein TRAI, DNA helicase I; RECD, hydrolase; NMR 97.74
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 97.73
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 97.69
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 97.69
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 97.62
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 97.55
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 97.53
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 97.44
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 97.41
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 97.37
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 97.32
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 97.21
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 97.17
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.05
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 97.0
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.95
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.95
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 96.92
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 96.85
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.7
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 96.45
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 96.33
3bos_A242 Putative DNA replication factor; P-loop containing 96.28
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.2
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 96.15
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 96.02
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 96.01
2gno_A305 DNA polymerase III, gamma subunit-related protein; 95.98
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 95.94
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.9
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 95.88
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 95.84
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 95.83
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.83
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 95.77
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 95.73
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 95.65
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.63
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.55
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 95.53
1yks_A440 Genome polyprotein [contains: flavivirin protease 95.53
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 95.51
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 95.5
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 95.49
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.45
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 95.43
1tue_A212 Replication protein E1; helicase, replication, E1E 95.4
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 95.34
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 95.23
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.21
2qgz_A308 Helicase loader, putative primosome component; str 95.19
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.18
1vma_A306 Cell division protein FTSY; TM0570, structural gen 95.17
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 95.02
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 95.02
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 95.01
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.01
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 95.0
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 94.97
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 94.97
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 94.88
2v1u_A387 Cell division control protein 6 homolog; DNA repli 94.88
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 94.83
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 94.82
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 94.74
2r62_A268 Cell division protease FTSH homolog; ATPase domain 94.69
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 94.6
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 94.55
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 94.53
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 94.52
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 94.48
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 94.47
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 94.4
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 94.39
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 94.35
3co5_A143 Putative two-component system transcriptional RES 94.33
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 94.32
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 94.3
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 94.29
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 94.25
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.23
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 94.23
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 94.23
1w36_C 1122 RECC, exodeoxyribonuclease V gamma chain; recombin 94.2
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 94.17
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 94.09
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 94.08
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 94.06
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 94.03
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 94.03
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 94.02
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 94.01
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 93.99
3io5_A333 Recombination and repair protein; storage dimer, i 93.99
2r6a_A454 DNAB helicase, replicative helicase; replication, 93.98
2r44_A331 Uncharacterized protein; putative ATPase, structur 93.97
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 93.94
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 93.92
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 93.91
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 93.87
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 93.82
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 93.82
2xxa_A433 Signal recognition particle protein; protein trans 93.8
2chq_A319 Replication factor C small subunit; DNA-binding pr 93.78
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 93.78
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 93.76
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 93.75
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 93.7
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 93.7
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 93.65
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 93.64
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 93.51
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 93.35
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 93.33
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 93.33
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 93.31
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 93.27
3pvs_A447 Replication-associated recombination protein A; ma 93.26
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 93.23
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 93.17
1u94_A356 RECA protein, recombinase A; homologous recombinat 93.1
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 93.09
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 93.09
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 93.07
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 93.06
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 93.05
2z43_A324 DNA repair and recombination protein RADA; archaea 93.01
1xjc_A169 MOBB protein homolog; structural genomics, midwest 92.99
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 92.96
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 92.96
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 92.94
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 92.93
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 92.88
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 92.87
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 92.87
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 92.84
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 92.81
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 92.8
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 92.79
2cvh_A220 DNA repair and recombination protein RADB; filamen 92.72
1p9r_A418 General secretion pathway protein E; bacterial typ 92.7
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 92.66
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 92.64
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 92.62
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 92.61
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 92.6
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 92.53
1xp8_A366 RECA protein, recombinase A; recombination, radior 92.5
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 92.44
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 92.41
1kag_A173 SKI, shikimate kinase I; transferase, structural g 92.39
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 92.37
2fna_A357 Conserved hypothetical protein; structural genomic 92.35
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 92.25
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 92.25
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 92.22
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 92.2
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 92.19
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 92.18
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 92.13
1via_A175 Shikimate kinase; structural genomics, transferase 92.13
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 92.06
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 92.03
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 92.01
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 92.0
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 91.97
3vaa_A199 Shikimate kinase, SK; structural genomics, center 91.97
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 91.92
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 91.89
2og2_A359 Putative signal recognition particle receptor; nuc 91.89
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 91.87
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 91.85
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 91.83
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 91.79
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 91.79
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 91.76
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 91.76
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 91.63
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 91.54
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 91.5
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 91.47
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 91.47
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 91.44
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 91.41
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 91.4
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 91.32
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 91.26
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 91.26
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 91.22
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 91.21
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 91.2
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 91.17
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 91.15
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 91.12
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 91.11
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 91.07
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 90.98
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 90.93
2vli_A183 Antibiotic resistance protein; transferase, tunica 90.92
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 90.91
3u4q_B 1166 ATP-dependent helicase/deoxyribonuclease subunit; 90.9
1ojl_A304 Transcriptional regulatory protein ZRAR; response 90.87
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 90.86
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 90.78
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 90.72
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 90.67
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 90.64
3tlx_A243 Adenylate kinase 2; structural genomics, structura 90.62
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 90.55
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 90.44
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 90.43
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 90.43
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 90.4
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 90.35
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 90.27
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 90.26
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 90.24
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 90.18
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 90.17
2ewv_A372 Twitching motility protein PILT; pilus retraction 90.16
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 90.12
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 90.07
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 90.07
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 89.95
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 89.93
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 89.93
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 89.82
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 89.78
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 89.7
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 89.7
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 89.69
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 89.67
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 89.65
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 89.61
3bs4_A260 Uncharacterized protein PH0321; structural genomic 89.6
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 89.44
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 89.36
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 89.36
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 89.3
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 89.07
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 88.98
2eyu_A261 Twitching motility protein PILT; pilus retraction 88.96
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 88.95
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 88.91
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 88.91
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 88.85
2oap_1511 GSPE-2, type II secretion system protein; hexameri 88.83
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 88.74
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 88.62
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 88.52
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 88.42
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 88.41
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 88.39
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 88.21
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 88.17
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 87.98
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 87.96
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 87.79
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 87.73
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 87.58
4a74_A231 DNA repair and recombination protein RADA; hydrola 87.58
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 87.53
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, 87.46
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 87.31
2www_A349 Methylmalonic aciduria type A protein, mitochondri 87.27
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 87.26
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 87.26
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 87.25
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 87.25
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 87.13
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 87.12
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 87.07
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 87.05
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 87.01
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 86.97
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 86.93
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 86.89
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 86.77
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 86.61
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 86.57
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 86.54
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 86.51
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 86.48
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 86.46
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 86.45
3r20_A233 Cytidylate kinase; structural genomics, seattle st 86.41
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 86.4
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 86.29
2woj_A354 ATPase GET3; tail-anchored, membrane protein, targ 86.24
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 86.17
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 86.15
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 86.14
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 85.94
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 85.85
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 85.81
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 85.8
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 85.74
3kta_A182 Chromosome segregation protein SMC; structural mai 85.54
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 85.36
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 85.35
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 85.33
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 85.29
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 85.28
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 85.24
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 84.97
3end_A307 Light-independent protochlorophyllide reductase ir 84.88
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 84.81
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 84.76
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 84.71
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 84.62
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 84.46
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 84.35
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 84.31
3ez2_A398 Plasmid partition protein A; type IA, DNA binding, 84.28
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 84.26
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 84.23
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 83.89
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 83.4
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 83.26
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 83.22
3cwq_A209 Para family chromosome partitioning protein; alpha 83.19
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 83.15
3igf_A374 ALL4481 protein; two-domained protein consisting o 83.11
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 83.02
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 82.98
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 82.78
2hf9_A226 Probable hydrogenase nickel incorporation protein 82.75
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 82.74
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 82.73
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 82.6
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 82.47
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 82.27
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 82.27
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 82.11
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 82.01
3ice_A422 Transcription termination factor RHO; transcriptio 81.93
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 81.76
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 81.73
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 81.62
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 81.52
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 81.47
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 81.31
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 81.2
3l0o_A427 Transcription termination factor RHO; helicase, RH 81.17
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 81.1
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 81.0
3fwy_A314 Light-independent protochlorophyllide reductase I 80.93
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 80.88
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 80.82
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 80.69
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 80.41
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 80.41
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 80.32
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 80.22
3pg5_A361 Uncharacterized protein; structural genomics, PSI- 80.21
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
Probab=100.00  E-value=5.2e-172  Score=1581.11  Aligned_cols=799  Identities=78%  Similarity=1.286  Sum_probs=720.4

Q ss_pred             cCCCccccCccCCCCCCceeecCccCceeecCCCCCCcchhhHHHHHcCCCeeeecCCCCCCcceeEeeccCCcceeeee
Q psy3251          95 KELPPHACKYCGIHDPAYVIMCNICKKWFCNGRGHTSGSHIINHLVRAKHKEVTLHKDGPLGETVLECYTCGVRNIFVLG  174 (959)
Q Consensus        95 ~~~~~~~c~yc~~~~~~~~~~c~~~~~wfcn~~~~~~~shi~~hlv~~~~~~~~lh~~~~~~~~~~ec~~c~~~n~f~lg  174 (959)
                      +++|+|||+|||||+|+|||+|++|+||||||||+|+|||||+||||||||||+||||||||||+||||+|||||||+||
T Consensus         2 ~~~~~~~c~~c~~~~~~~~~~~~~~~~~fcn~~~~~~~shi~~h~~~~~~~~~~~~~~~~~~~~~~ec~~c~~~n~f~lg   81 (800)
T 2wjy_A            2 KDLPIHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGPLGETVLECYNCGCRNVFLLG   81 (800)
T ss_dssp             CCCCTTSCTTTCCCCGGGEEEETTTTEEEESCCTTSSSCHHHHHHHHHTCCCEEECTTSTTCSCBCCCTTTCCCCTTTCE
T ss_pred             CCCCchhccccCCCCCCeEEEcCCCCCccccCCCCCcccHHHHHHHHccCceEecCCCCCCCCceEEEeccCCCceeeee
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeccCCcEEEEEeCCcccccccccccCCCCCCccccccccccccccccCCCHHHhhhccCCCHHHHHHHHHHHhhCccc
Q psy3251         175 FIPAKADSVVVLLCRTPCAAQNSLKDMNWDQEQWKPLIADRSFLSWLVKVPTEQEQQRGRQVTSAQIAKLEEVWKDNAEA  254 (959)
Q Consensus       175 f~~~~~~~~~~~~cr~~c~~~~~~~~~~~d~~~w~pli~~~~~~~~~~~~p~~~~~~~~~~~~~~~i~~le~~w~~~~~~  254 (959)
                      |||+|+|+||||+||+||++.+++||+|||+++|||||+|||||||||++|+++||.+||+||++||+||||+||.||+|
T Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~  161 (800)
T 2wjy_A           82 FIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQDRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPSA  161 (800)
T ss_dssp             EEC-----CCEECCTTTTSSTTC----------CEESBCSSSBCTTTSCCCCHHHHHHSCCCCHHHHHHHHHHHTTCTTC
T ss_pred             ceecccCceEEEEecCcccccchhhccCCCHHhcccccccccccHhhcCCCCHHHHhhhcCCCHHHHHHHHHHhccCcCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccCCCCCCCccccccccCChHHHHHhhhhHHHhhhHHHHHHhhhccccceEEEEeccCCceeEEEEEccccCCCcc
Q psy3251         255 TFQDLEKPGVDEDPHQVLLRYEDGYQYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDGY  334 (959)
Q Consensus       255 ~~~~~~~~~~~~~~~~~~~~y~~~~~y~~~f~~lv~~e~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~  334 (959)
                      |++|+|+++.++++++|+++|+|+++|+++|.||+++|++||+.++|++.+.+++++|+.++++|.+++|.++..+    
T Consensus       162 ~~~~~~~~~~~~~~~~v~~~y~~~~~Y~~~~~~l~~lE~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----  237 (800)
T 2wjy_A          162 TLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTD----  237 (800)
T ss_dssp             CTTC--------CCCCCCSCCSCHHHHHHHHHHHHHHHHHHHHHHHHHTCEEEECCEEEECTTCCEEEEECCCBCC----
T ss_pred             chhhhhhccccccccccccccCCHHHHHHHHHHHHHHHHHhhhhhhhhhhccceEEEEEecCCCeeEEEEEecccc----
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999887632    


Q ss_pred             ccccccchhhhhhhhhhhhhhhcccccceeeeeecccccceeeEeeecccCCCCCCCCCCEEEEEEccCCCCcceeEEEE
Q psy3251         335 QYQNIFGPLVKLEADYDKRLKESQTQENVTVRWDVGLNKKSIAYFSLAKTDGDMRLMQGDELKLRYSYDASKTWSGLGHV  414 (959)
Q Consensus       335 ~Y~~~f~pLi~lea~~~~~~kes~~~~nvtvr~~~~~~~k~~~~f~~~~~~~~~~l~~GD~v~l~~~~~~~~~~~~~g~v  414 (959)
                                                                         .+.++..||.|.|++.+.....|.+.|+|
T Consensus       238 ---------------------------------------------------~~~~l~~GD~v~l~~~~~~~~~~~~~g~V  266 (800)
T 2wjy_A          238 ---------------------------------------------------SDMRLMQGDEICLRYKGDLAPLWKGIGHV  266 (800)
T ss_dssp             ---------------------------------------------------C--CCCTTCEEEEEECSSSSCCEEEEEEE
T ss_pred             ---------------------------------------------------CCCCCCCCCEEEEEECCCCCCCceeEEEE
Confidence                                                               36789999999999988877789999999


Q ss_pred             EecCCCCCCeEEEEeccCCCCCCCCCcceEEEEeeCccHHHHHHHHHHHHHHhhhhhHHHHHHHhcCCCcchhhcccCCC
Q psy3251         415 IKIPDNFGDEVGLELKSSAGAPTEATTGFSVDFIWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLP  494 (959)
Q Consensus       415 ~~~~~~~~~ev~l~l~~~~~~p~~~~~~~~v~~~~~~~~~~R~~~aL~~~~~~~~~~~~~i~~~llg~~~~~~~~~~~~p  494 (959)
                      +++.+++.++|.+++......|......|.++|+|++++|+||+.||++++.++.+++.++++.++|+..++..++..+|
T Consensus       267 ~~v~~~~~~~v~l~~~~~~~~p~~~~~~~~v~~~~~~~~~~r~~~aL~~~~~~e~~~~~~l~~~ll~~~~~~~~~~~~l~  346 (800)
T 2wjy_A          267 IKVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLP  346 (800)
T ss_dssp             EECSBTTBSCEEEEESCCTTCCTTCCSCEEEEECCCCHHHHHHHHHHHHHHHCTTSBCHHHHHHHTTCCCCCCCCCCCCC
T ss_pred             EEEcCCCCCEEEEEEccCCCCccccCCCceEEEeecCChHHHHHHHHHHHHHhhcchhHHHHHHhcCCCCCchhhcccCc
Confidence            99998777899999876666777767789999999999999999999999998888888999999998766555555667


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHhcCCcEEEEcCCCChHHHHHHHHHHHHHHccCCCEEEEcccHHHHHHHHHHHHhcCCe
Q psy3251         495 KHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGPPGTGKTVTSATIVYQLVKQTGSPVLVCAPSNIAVDQLTEKIHRTGLK  574 (959)
Q Consensus       495 ~~~~~~~~~~LN~sQ~~AV~~al~~~l~LIqGPPGTGKT~Tia~ii~~Ll~~~~~rILV~ApSN~AvD~L~erL~~~gl~  574 (959)
                      ..|..+....||++|++||..++.+++++|+||||||||+|+++++.+|++..+.+||+|||||.|||+|.++|.+.+++
T Consensus       347 ~~~~~~~~~~Ln~~Q~~Av~~~l~~~~~lI~GppGTGKT~ti~~~i~~l~~~~~~~ilv~a~tn~A~~~l~~~l~~~g~~  426 (800)
T 2wjy_A          347 KRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLK  426 (800)
T ss_dssp             SCCSCTTSCCCCHHHHHHHHHHHTSSEEEEECCTTSCHHHHHHHHHHHHHTTCSSCEEEEESSHHHHHHHHHHHHTTTCC
T ss_pred             cccccccccCCCHHHHHHHHHhccCCeEEEEcCCCCCHHHHHHHHHHHHHHcCCCcEEEEcCcHHHHHHHHHHHHHhCcc
Confidence            76766677889999999999999999999999999999999999999988766789999999999999999999999999


Q ss_pred             EEEeecccccccCCchhHHHHHHHHHhhhhhHHHHHHHHHHHHhccCChHHHHHHHHHHHHHHHHhhccCceeeeecccc
Q psy3251         575 VVRVCAKSREAIDSPVSFLALHNQIRNMEMNSELKKLLQLKEETGELSSADEKRYRMLKKNAEKSLLDNADVICCTCVGA  654 (959)
Q Consensus       575 vvRl~~~sre~i~~~~~~l~l~~~i~~~~~~~~l~kl~~lk~~~~~ls~~~~k~~~~l~~~~e~~lL~~a~VI~~T~~~a  654 (959)
                      ++|+++.+++.+..++...++|..++.......++++.+++.+.+.++..+++.|+.+.+..+..+++.++||++|+.++
T Consensus       427 vvRlg~~~r~~i~~~~~~~tlh~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~VI~~T~~~~  506 (800)
T 2wjy_A          427 VVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGA  506 (800)
T ss_dssp             EEECCCGGGGGCCCTTGGGBHHHHHHTCTTCHHHHHHHHHHTTTSCCCHHHHHHHHHHHHHHHHHHHHHCSEEEEETGGG
T ss_pred             eEeecccchhhhcchhhhhhHHHHHHcCccHHHHHHHHHHHHhhcccChHHHHHHHHHHHHHHHhhhccCCEEEEchhhh
Confidence            99999999988888888889999988877777788888887777778877778888888888889999999999999999


Q ss_pred             CCcccccCCcCEEEEECCCCCChhhhHhhhhhcCCeEEEEccCCCCCceeechhHHhhcCcHHHHHHHHHcCCccEEecc
Q psy3251         655 GDPRLLKIKFHSILIDESMQATEPECMVPVILGAKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFRLEV  734 (959)
Q Consensus       655 ~~~~l~~~~fd~VIIDEAsQ~~Epe~Lipl~~~~krvVLVGD~~QL~Pvv~s~~a~~~gl~~SLFeRL~~~g~~~~~L~~  734 (959)
                      ++..+....||+||||||+|+++|++|+|+..+++++||||||+||||++.+..+...|+..|+|+|+...+..+++|++
T Consensus       507 ~~~~l~~~~fd~viIDEAsQ~~e~~~li~l~~~~~~~ilvGD~~QLpPvv~s~~a~~~gl~~SlFerL~~~g~~~~~L~~  586 (800)
T 2wjy_A          507 GDPRLAKMQFRSILIDESTQATEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQV  586 (800)
T ss_dssp             GCTTTTTCCCSEEEETTGGGSCHHHHHHHHTTTBSEEEEEECTTSCCCCCCCHHHHHTTTTSCHHHHHHHTTCCCEECCE
T ss_pred             CChhhhcCCCCEEEEECCCCCCcHHHHHHHHhcCCeEEEecccccCCCeecchhhhhcCcchHHHHHHHhCCCCceEehh
Confidence            98888888999999999999999999999998889999999999999999999888999999999999998989999999


Q ss_pred             ccCCchhHhhhhhhhhccCCcccccccccccccCCCCCCCCCCCCeEEEEcCCcceeccCCCcccCHHHHHHHHHHHHHH
Q psy3251         735 QYRMHPELSKFPSNFFYEGSLQNGVCADERKLSKIDFPWPVPDKPMLFYVTQGQEEIAGSGTSYVNRTEASNVEKITTRF  814 (959)
Q Consensus       735 qYRmhp~I~~f~s~~fY~g~L~~~~~~~~r~~~~~~~~~p~~~~p~~f~~~~g~ee~~~~g~S~~N~~EA~~V~~iv~~L  814 (959)
                      ||||||+|++|+|..||+|.|.++.....+......++|+.+..|++|+++.|.++....+.|+.|..||+.|.+++..|
T Consensus       587 qYRm~p~I~~f~n~~fY~g~L~~~~~~~~r~~~~~~~~~~~~~~p~~f~~~~g~e~~~~~~~S~~N~~Ea~~V~~~v~~L  666 (800)
T 2wjy_A          587 QYRMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKL  666 (800)
T ss_dssp             ECSSCHHHHHHHHHHHSTTCCEESSCSGGGSCTTCCCCCSSTTSCEEEEECCCCCEECSSBSCEECHHHHHHHHHHHHHH
T ss_pred             hcCCCcHHHHhhHHHhcCCccccCCchhhhccccccccccCCCCCEEEEEcCCceeecCCCCcccCHHHHHHHHHHHHHH
Confidence            99999999999999999999998877766666566788988899999999999988888899999999999999999999


Q ss_pred             HHcCCCCCcEEEEccChHHHHHHHHHHHhcCCCCcccCCceEEeecccCCCccccEEEEEccccCCCCCccCCCCcCcee
Q psy3251         815 IRCGMKPEQIGVITPYEGQRAFLVQHMQYQGSLPAKIYQEIEVASVDAFQGREKDLIIMSCVRSNDHQGIGFLNDPRRLN  894 (959)
Q Consensus       815 l~~g~~~~~IgIITPY~~Q~~~L~~~L~~~~~~~~~~~~~V~V~TVd~fQG~E~DiVIlS~Vrsn~~~~iGFl~d~rRLN  894 (959)
                      ++.|+++++|||||||++|+..|++.|...+.+.......|+|+|||+|||+|+|+||+|+||++..+++||+.|+||||
T Consensus       667 ~~~g~~~~dIgVItPy~~Q~~~I~~~L~~~~~~~~~~~~~v~V~TVd~fQG~E~dvVIlS~vrs~~~~~~gfl~d~rrLN  746 (800)
T 2wjy_A          667 LKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLN  746 (800)
T ss_dssp             HHTTCCGGGEEEECSCHHHHHHHHHHHHHHCSSCHHHHHTSEEECGGGGTTCCEEEEEEECCCCSCCCCCGGGTCHHHHH
T ss_pred             HHcCCCcccEEEEeccHHHHHHHHHHHHhcCcccccccCceEEccccccCCCcCCEEEEEecCCCCccccccccCcchhh
Confidence            99999999999999999999999999987765544445689999999999999999999999999888999999999999


Q ss_pred             ecchhhcccEEEEEccccccCCchHHHHHHHHHHcCceeeccCcchhhhcccCC
Q psy3251         895 VALTRAKYGIIVIGNPKVLSKQPLWNNLLNFYKEQKVLVEGPLNNLKESLILFS  948 (959)
Q Consensus       895 VAlTRAK~~LiIvGn~~~L~~~~~W~~ll~~~~~~~~~v~g~~~~l~~~~~~~~  948 (959)
                      ||+||||++|+||||+.+|+.+++|+.|++|++++|++++|++++|++++++|+
T Consensus       747 VAlTRAk~~LiIvG~~~~l~~~~~w~~ll~~~~~~~~~~~~~~~~l~~~~~~~~  800 (800)
T 2wjy_A          747 VALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVEGPLNNLRESLMQFS  800 (800)
T ss_dssp             HHHTSEEEEEEEEECHHHHTSSHHHHHHHHHHHHTTCEEESCGGGCEECCCCC-
T ss_pred             hhHHhhhccEEEEECHHHhccCHHHHHHHHHHHHCCCEEeCCHHHhhhhcccCC
Confidence            999999999999999999999999999999999999999999999999999885



>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* Back     alignment and structure
>3dmn_A Putative DNA helicase; APC89291.2, lactobacillus plantarum WCFS1, STR genomics, PSI-2, midwest center for structural genomics; HET: MSE; 1.66A {Lactobacillus plantarum} Back     alignment and structure
>3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1w36_C RECC, exodeoxyribonuclease V gamma chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.25 PDB: 3k70_C* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 959
d1w36d1359 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha c 4e-21
d1uaaa1306 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escheri 5e-06
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 1e-05
d1pjra1318 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillu 3e-05
g1qhh.1 623 c.37.1.19 (A:,B:,C:,D:) DEXX box DNA helicase {Bac 3e-04
d1w36d2246 c.37.1.19 (D:361-606) Exodeoxyribonuclease V alpha 0.001
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 0.001
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Length = 359 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Exodeoxyribonuclease V alpha chain (RecD)
species: Escherichia coli [TaxId: 562]
 Score = 93.8 bits (232), Expect = 4e-21
 Identities = 51/280 (18%), Positives = 90/280 (32%), Gaps = 63/280 (22%)

Query: 454 FDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAV 513
               +L L +   ++++V+ +         VDE L    L K F      D    Q  A 
Sbjct: 101 LCGDRLYLNRMWCNERTVARFFNEVNHAIEVDEALLAQTLDKLFPVS---DEINWQKVAA 157

Query: 514 KHAIQRPLSLIQGPPGTGKTVTSATIVYQLVKQ---TGSPVLVCAPSNIAVDQLTEKIHR 570
             A+ R +S+I G PGTGKT T A ++  L++        + + AP+  A  +LTE    
Sbjct: 158 AVALTRRISVISGGPGTGKTTTVAKLLAALIQMADGERCRIRLAAPTGKAAARLTES--- 214

Query: 571 TGLKVVRVCAKSREAIDSPVSFLALHNQIRNMEMNSELKKLLQLKEETGELSSADEKRYR 630
            G  + ++     +    P     LH  +     +  L+                     
Sbjct: 215 LGKALRQLPLTDEQKKRIPEDASTLHRLLGAQPGSQRLRH-------------------- 254

Query: 631 MLKKNAEKSLLDNADVICCTCVGAGDPRLLKIKFHSILIDESMQATEPEC--MVPVILGA 688
                                          +    +++DE+     P    ++  +   
Sbjct: 255 --------------------------HAGNPLHLDVLVVDEASMIDLPMMSRLIDALPDH 288

Query: 689 KQLILVGDHCQLGPVVMCK------KAARAGLSQSLFERL 722
            ++I +GD  QL  V            A AG +     +L
Sbjct: 289 ARVIFLGDRDQLASVEAGAVLGDICAYANAGFTAERARQL 328


>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Length = 306 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Length = 318 Back     information, alignment and structure
>d1w36d2 c.37.1.19 (D:361-606) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Length = 246 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query959
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 99.92
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 99.87
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 99.84
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 99.78
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 99.45
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.64
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 98.62
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 98.6
d1w36b2 395 Exodeoxyribonuclease V beta chain (RecB), N-termin 98.6
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 98.54
d1pjra2 333 DEXX box DNA helicase {Bacillus stearothermophilus 98.5
d1uaaa2333 DEXX box DNA helicase {Escherichia coli, RepD [Tax 98.42
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 98.42
d1w36d2246 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 98.34
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 98.31
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 98.29
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 98.24
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 98.12
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 98.07
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 98.06
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 98.04
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 98.01
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 98.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 97.94
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 97.91
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 97.89
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 97.82
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 97.76
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 97.75
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 97.19
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.08
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.01
d1okkd2207 GTPase domain of the signal recognition particle r 96.93
d2qy9a2211 GTPase domain of the signal recognition particle r 96.9
d1vmaa2213 GTPase domain of the signal recognition particle r 96.74
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.73
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.67
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.65
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.64
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.51
d1w36c2470 Exodeoxyribonuclease V gamma chain (RecC), N-termi 96.39
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.37
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.29
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.17
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.15
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.06
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.05
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.04
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.02
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.92
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 95.91
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.85
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.84
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 95.77
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.61
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.58
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.56
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.51
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.5
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.45
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 95.45
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.35
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.29
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.25
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.21
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.18
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.1
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 94.99
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 94.92
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 94.92
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.91
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 94.81
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 94.77
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.75
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 94.68
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 94.66
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.62
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 94.52
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.48
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.31
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.28
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.24
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.2
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 94.13
d1svma_362 Papillomavirus large T antigen helicase domain {Si 94.07
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.02
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 94.01
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 93.98
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 93.91
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 93.84
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.8
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 93.79
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 93.75
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 93.67
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 93.67
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 93.64
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 93.54
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 93.46
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 93.26
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 93.18
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.16
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 93.13
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 93.12
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 92.88
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 92.79
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 92.75
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 92.74
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 92.74
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 92.54
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 92.35
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 92.33
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.31
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.17
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 92.15
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 92.11
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 92.07
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 92.06
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 91.8
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 91.53
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 91.53
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 91.32
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 91.3
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 91.19
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 91.16
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 90.54
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 90.06
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 89.92
d2g45a1113 Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Hum 89.6
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 89.33
d2uzga195 Ubiquitin carboxyl-terminal hydrolase 33, UBP33 {H 89.18
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 88.9
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 88.33
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 88.17
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 88.15
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 88.08
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 88.0
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 87.86
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 87.64
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 86.6
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 86.53
d1xpua3289 Transcription termination factor Rho, ATPase domai 86.51
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 86.18
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 86.05
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 85.47
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 85.4
d1tuea_205 Replication protein E1 helicase domain {Human papi 85.18
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 84.68
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 83.68
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 83.36
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 82.84
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 82.53
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 81.58
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 81.49
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 81.35
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 81.23
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 81.0
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 80.33
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 80.17
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1pjra2 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1uaaa2 c.37.1.19 (A:308-640) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1w36d2 c.37.1.19 (D:361-606) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w36c2 c.37.1.19 (C:348-817) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g45a1 g.44.1.5 (A:173-285) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2uzga1 g.44.1.5 (A:36-130) Ubiquitin carboxyl-terminal hydrolase 33, UBP33 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure