Diaphorina citri psyllid: psy3252

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-----
MKIEKFGPRKYEIEASRAQTWSRRAAAYEQSRAEPHLQMKRYLAPTNGTLSVDGAAGSFKNFKSSEPRTNLEPPCRGVRTVASREPHLQMKRYLAPTNGTLSVTGGSSGIGKHVAIEAAKRGAHVTIVARDEKKLLQAQEEIKKACPNPKFIRFIEYEEIKKACPNPKFIRFIEYVSLDISKDYENIRSALQPAMDRCGPVYMLVNCAGMALCGTLEEMTMQDIKVMEQPLWLRGYHTRLALWRSWTVIDLNLYGTIHMTKALVEGMKQRGRGCIVITASQAANLGIYGLAAYTSSKFALKGFAEALYMEVKQSGLTITLCLPPDTDTPGFENEEKSKPRETSLISQTGGLYRPEVVKQSGLTITLCLPPDTDTPGFENEEKSKPRETSLISQTGGLYRPEVVAKQLLEDALKGNYFSTVGLESYLITTLCAGFSPIVSIQETFIQAFLMGPLRLTAIYLHWTFDNIVKKCRKSQ
cccccccccccEEEccccHHHHHHHHHHHHHccccHHHHHcccccccccCECcccccccccccccccccccccccccHHHccccccHHcccccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccEEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHHHHHHcccccccccccccccEEEEEHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
******G*RKYEIEAS***TW***AAAYE**RAE**LQMKRYLAPTNGTLSVDGAAGSFKNFKSSEPRTNLEPPCRGVRTVASREPHL****YLAPTNGTLSVTGGSSGIGKHVAIEAAKRGAHVTIVARDEKKLLQAQEEIKKACPNPKFIRFIEYEEIKKACPNPKFIRFIEYVSLDISKDYENIRSALQPAMDRCGPVYMLVNCAGMALCGTLEEMTMQDIKVMEQPLWLRGYHTRLALWRSWTVIDLNLYGTIHMTKALVEGMKQRGRGCIVITASQAANLGIYGLAAYTSSKFALKGFAEALYMEVKQSGLTITLCLPPDTDTPGFEN****************GLYRPEVVKQSGLTITLCLPPDTDTPGFENEEKSKPRE***ISQTGGLYRPEVVAKQLLEDALKGNYFSTVGLESYLITTLCAGFSPIVSIQETFIQAFLMGPLRLTAIYLHWTFDNIVKKCRK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIEKFGPRKYEIEASRAQTWSRRAAAYEQSRAEPHLQMKRYLAPTNGTLSVDGAAGSFKNFKSSEPRTNLEPPCRGVRTVASREPHLQMKRYLAPTNGTLSVTGGSSGIGKHVAIEAAKRGAHVTIVARDEKKLLQAQEEIKKACPNPKFIRFIEYEEIKKACPNPKFIRFIEYVSLDISKDYENIRSALQPAMDRCGPVYMLVNCAGMALCGTLEEMTMQDIKVMEQPLWLRGYHTRLALWRSWTVIDLNLYGTIHMTKALVEGMKQRGRGCIVITASQAANLGIYGLAAYTSSKFALKGFAEALYMEVKQSGLTITLCLPPDTDTPGFENEEKSKPRETSLISQTGGLYRPEVVKQSGLTITLCLPPDTDTPGFENEEKSKPRETSLISQTGGLYRPEVVAKQLLEDALKGNYFSTVGLESYLITTLCAGFSPIVSIQETFIQAFLMGPLRLTAIYLHWTFDNIVKKCRKSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
3-ketodihydrosphingosine reductase Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).confidentQ2KIJ5
3-ketodihydrosphingosine reductase Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).confidentQ06136
3-ketodihydrosphingosine reductase Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).confidentQ6GV12

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006629 [BP]lipid metabolic processprobableGO:0044238, GO:0044710, GO:0008150, GO:0008152, GO:0071704
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0016491 [MF]oxidoreductase activityprobableGO:0003824, GO:0003674
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ET6, chain A
Confidence level:very confident
Coverage over the Query: 94-146,171-227,249-376
View the alignment between query and template
View the model in PyMOL
Template: 2ET6, chain A
Confidence level:very confident
Coverage over the Query: 94-146,171-227,249-330,349-413
View the alignment between query and template
View the model in PyMOL
Template: 3IOY, chain A
Confidence level:very confident
Coverage over the Query: 93-148,171-227,249-327,391-424
View the alignment between query and template
View the model in PyMOL
Template: 4BB6, chain A
Confidence level:probable
Coverage over the Query: 103-147,159-167,180-192,204-368
View the alignment between query and template
View the model in PyMOL
Template: 3G1T, chain A
Confidence level:probable
Coverage over the Query: 88-194,211-226,243-328
View the alignment between query and template
View the model in PyMOL