Diaphorina citri psyllid: psy3259


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------7
MSLLGFEPESFPDSPQHSLTVLLLGESGLVYCMEQIFLYGFKSSRLFSRNLNIWDLFIKIYQEIFSYTF
cccccccccccccccccccEEEEcccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccc
******************LTVLLLGESGLVYCMEQIFLYGFKSSRLFSRNLNIWDLFIKIYQEIFSYTF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLLGFEPESFPDSPQHSLTVLLLGESGLVYCMEQIFLYGFKSSRLFSRNLNIWDLFIKIYQEIFSYTF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DENN domain-containing protein 5B confidentQ6ZUT9
DENN domain-containing protein 5B confidentA2RSQ0
DENN domain-containing protein 5B confidentQ6NXD8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0017137 [MF]Rab GTPase bindingprobableGO:0019899, GO:0017016, GO:0031267, GO:0051020, GO:0003674, GO:0005488, GO:0005515
GO:0017112 [MF]Rab guanyl-nucleotide exchange factor activityprobableGO:0005088, GO:0005083, GO:0005085, GO:0030695, GO:0003674, GO:0060589, GO:0030234

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GIW, chain A
Confidence level:probable
Coverage over the Query: 13-61
View the alignment between query and template
View the model in PyMOL