Diaphorina citri psyllid: psy3272

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MGMMSWYQDTFLIEPSVSDRRLMETRGNKHTLTIKNVQSTDFGNYSCVADNNLGRAKKYMELSVSVSDRRLMETRGNKHTLTIKNVQSTDFGNYSCVADNNLGRAKKYMELSELE
ccEEEEEEccCECcccccccEEEEECccEEEEEEEcccccccCEEEEEEECccCEEEEEEEEEEEcccCEEEECcccCEEEEEccccccccCEEEEEEEccccCEEEEEEEEEcc
MGMMSWYQDTFLIEPSVSDRRLMETRGNKHTLTIKNVQSTDFGNYSCVADNNLGRAKKYMELSVSVSDRRLMETRGNKHTLTIKNVQSTDFGNYSCVADNNLGRAKKYMELSELE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGMMSWYQDTFLIEPSVSDRRLMETRGNKHTLTIKNVQSTDFGNYSCVADNNLGRAKKYMELSVSVSDRRLMETRGNKHTLTIKNVQSTDFGNYSCVADNNLGRAKKYMELSELE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0031672 [CC]A bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0031674 [CC]I bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043167 [MF]ion bindingprobableGO:0003674, GO:0005488
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0007156 [BP]homophilic cell adhesionprobableGO:0016337, GO:0009987, GO:0044763, GO:0007155, GO:0008150, GO:0022610, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V2A, chain R
Confidence level:very confident
Coverage over the Query: 2-9,20-62
View the alignment between query and template
View the model in PyMOL