Diaphorina citri psyllid: psy3274


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MKARHIYICEYHKCLIQSVRNKRRRKDSEDDSNENDESPDVDLFQLQVNTLRRYKKYFKVTSRPGLNKAQLAETLLKHFKTIPVVEKDVLSFFFYTVKSNTNKLDQKNGNTGENT
cccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccccccccc
***RHIYICEYHKCLIQS***********************DLFQLQVNTLRRYKKYFKVTSRPGLNKAQLAETLLKHFKTIPVVEKDVLSFFFYTVK*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKARHIYICEYHKCLIQSVRNKRRRKDSEDDSNENDESPDVDLFQLQVNTLRRYKKYFKVTSRPGLNKAQLAETLLKHFKTIPVVEKDVLSFFFYTVKSNTNKLDQKNGNTGENT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histone deacetylase complex subunit SAP30 homolog Component of the class 1 Sin3A-histone deacetylase (Rpd3) complex (HDAC). Appears to be a non-essential subunit of this complex which is not required for cell cycle regulation of progression through the G2 phase of the cell cycle.confidentQ29IK8
Histone deacetylase complex subunit SAP30 homolog Required for the function of the class 1 Sin3-histone deacetylase complex (HDAC).confidentQ7PXY4
Histone deacetylase complex subunit SAP30 homolog Component of the class 1 Sin3A-histone deacetylase (Rpd3) complex (HDAC). Appears to be a non-essential subunit of this complex which is not required for cell cycle regulation of progression through the G2 phase of the cell cycle.confidentQ9VXB3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003714 [MF]transcription corepressor activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0005488 [MF]bindingprobableGO:0003674
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0000118 [CC]histone deacetylase complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LD7, chain A
Confidence level:very confident
Coverage over the Query: 24-113
View the alignment between query and template
View the model in PyMOL
Template: 2KDP, chain A
Confidence level:very confident
Coverage over the Query: 2-28
View the alignment between query and template
View the model in PyMOL