Diaphorina citri psyllid: psy3276


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--
MNGFSIGEEDSHGPTDLQQICCLVDDGVRCPRPIGNASYSKRIQQIVTQKRLKLHLDNFREL
cccccccccccccccccccEEEEECcccccccccccccHHHHHHHHHHHHHHcccccccccc
****************LQQICCLVDDGVRCPRPIGNASYSKRIQQIVTQKRLKLHLD*FR**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNGFSIGEEDSHGPTDLQQICCLVDDGVRCPRPIGNASYSKRIQQIVTQKRLKLHLDNFREL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histone deacetylase complex subunit SAP30 homolog Required for the function of the class 1 Sin3-histone deacetylase complex (HDAC).confidentQ7PXY4
Histone deacetylase complex subunit SAP30L Required for the function of the class 1 Sin3-histone deacetylase complex (HDAC).confidentQ28H91
Histone deacetylase complex subunit SAP30 homolog Component of the class 1 Sin3A-histone deacetylase (Rpd3) complex (HDAC). Appears to be a non-essential subunit of this complex which is not required for cell cycle regulation of progression through the G2 phase of the cell cycle.confidentQ9VXB3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003714 [MF]transcription corepressor activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0000118 [CC]histone deacetylase complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KDP, chain A
Confidence level:very confident
Coverage over the Query: 18-61
View the alignment between query and template
View the model in PyMOL