Diaphorina citri psyllid: psy327

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHHAETLKPRCSACDEVRVQVGGHRTRDLNINYFSSLPAGQMSHEGQHWHATDSCFCCATCSLSLLGRPFLPRAGVIFCSIACSKGEPPTPSDSSGPGLRPQRPRKSSKAAVTAGPEERGESPSR
cEEEEccccccccccccccccccccccccccccEECccCEcccHHHHHHcccccccccccccccccCEECccccccccccccccEEEcccccccccccEEcccccccccccccCCcccEEEEcccccccccccccccccccccccccccCECcCECcccccccccccc
MSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHHAETLKPRCSACDEVRVQVGGHRTRDLNINYFSSLPAGQMSHEGQHWHATDSCFCCATCSLSLLGRPFLPRAGVIFCSIACSKG***************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHHAETLKPRCSACDEVRVQVGGHRTRDLNINYFSSLPAGQMSHEGQHWHATDSCFCCATCSLSLLGRPFLPRAGVIFCSIACSKGEPPTPSDSSGPGLRPQRPRKSSKAAVTAGPEERGESPSR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein espinas confidentQ292U5
Protein prickle Acts in a planar cell polarity (PCP) complex; polarization along the apical/basal axis of epithelial cells. PCP signaling in the wing disk requires the receptor fz and the cytoplasmic proteins dsh and pk. These act in a feedback loop leading to activation of the jnk cascade and subsequent polarized arrangement of hairs and bristles. Dgo and pk compete with one another for dsh binding, thereby modulating fz dsh activity and ensuring tight control over fz PCP signaling. Vang, stan and pk function together to regulate the establishment of tissue polarity in the adult eye.confidentQ7QJT4
Protein espinas confidentQ9U1I1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0090090 [BP]negative regulation of canonical Wnt receptor signaling pathwayprobableGO:0009968, GO:0008150, GO:0009966, GO:0048585, GO:0048583, GO:0048519, GO:0050794, GO:0050789, GO:0023057, GO:0030111, GO:0065007, GO:0010648, GO:0023051, GO:0048523, GO:0010646, GO:0030178, GO:0060828
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0048598 [BP]embryonic morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0031398 [BP]positive regulation of protein ubiquitinationprobableGO:0032268, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0031325, GO:0031401, GO:0031323, GO:0051247, GO:0050794, GO:0008150, GO:0048518, GO:0032270, GO:0031399, GO:0031396, GO:0065007, GO:0019222, GO:0010604, GO:0050789, GO:0048522
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0032436 [BP]positive regulation of proteasomal ubiquitin-dependent protein catabolic processprobableGO:0009896, GO:0009894, GO:0009893, GO:0032434, GO:0031325, GO:0031323, GO:0042176, GO:0050789, GO:0080090, GO:0031329, GO:0051246, GO:0051247, GO:0008150, GO:0032270, GO:1901800, GO:0048518, GO:0065007, GO:0060255, GO:0031331, GO:0050794, GO:0030162, GO:0019222, GO:0010604, GO:0032268, GO:0045732, GO:0061136, GO:0045862, GO:0048522
GO:2000691 [BP]negative regulation of cardiac muscle cell myoblast differentiationprobableGO:2000736, GO:2000737, GO:0048634, GO:0065007, GO:0051147, GO:0051892, GO:0051148, GO:0051890, GO:0050789, GO:0051154, GO:2000690, GO:0060284, GO:0045661, GO:0045662, GO:0048641, GO:1901861, GO:0016202, GO:2000725, GO:2000726, GO:0050793, GO:0055024, GO:0048742, GO:0050794, GO:0051153, GO:0045595, GO:0008150, GO:0051239, GO:0048519, GO:0051093, GO:0045596, GO:2000026, GO:0048523
GO:0031965 [CC]nuclear membraneprobableGO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0002009 [BP]morphogenesis of an epitheliumprobableGO:0032502, GO:0048856, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0048729, GO:0009653, GO:0044699
GO:0007399 [BP]nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XQN, chain T
Confidence level:very confident
Coverage over the Query: 7-67,83-129
View the alignment between query and template
View the model in PyMOL
Template: 1B8T, chain A
Confidence level:very confident
Coverage over the Query: 7-142
View the alignment between query and template
View the model in PyMOL