Diaphorina citri psyllid: psy3288


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------
MLQISGCKARVSLSDIRLPLMWRDSDYFKNKGDYRRFAVFCLVRSGTELYDTSLLCPVDRSHTDLTFQDVLLLVVVVSAVDFGSGGWWFESKSIVWV
cccccccccEEEEcccEEEEEECccccccccccccEEEEEEEEEEccEEECccEEEECccccCEEECccEEEEEEEcccCCccccccccEEEEEEEc
******CKARVSLSDIRLPLMWRDSDYFKNKGDYRRFAVFCLVRSGTELYDTSLLCPVDRSHTDLTFQDVLLLVVVVSAVDFGSGGWWFESKSIVWV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQISGCKARVSLSDIRLPLMWRDSDYFKNKGDYRRFAVFCLVRSGTELYDTSLLCPVDRSHTDLTFQDVLLLVVVVSAVDFGSGGWWFESKSIVWV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Rhotekin Mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. May play a novel role in the organization of septin structures.confidentQ8C6B2
Rhotekin Mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. May play a novel role in the organization of septin structures.confidentQ9BST9
Rhotekin Mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. May play a novel role in the organization of septin structures.confidentQ6V7V2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0017049 [MF]GTP-Rho bindingprobableGO:0019899, GO:0017016, GO:0031267, GO:0051020, GO:0003674, GO:0017048, GO:0005515, GO:0005488
GO:0007266 [BP]Rho protein signal transductionprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0050789, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0007265, GO:0007264, GO:0035556, GO:0044699
GO:0005095 [MF]GTPase inhibitor activityprobableGO:0030695, GO:0004857, GO:0060589, GO:0030234, GO:0003674

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted