Psyllid ID: psy3307


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MQECLVSLKKQGFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVL
cccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHHHcccccccEEEc
ccccccccccccHHHccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHcccccEEEEc
MQECLVSLkkqgfddiqMTEIITNNialarydkptpvqkyaIPVIIsgrdvmacaqtgsgktaAFLVPILNQmyergplptppagrgypsrkkvfplglvlapTRELATQIYDEAKKFayrsqlrpcvvl
MQECLVSLkkqgfddiqMTEIITNNialarydkptpVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKfayrsqlrpcvvl
MQECLVSLKKQGFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVL
****LVSLKKQGFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYER***************KKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPC***
****LVS*KKQGFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMY*******************VFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVL
MQECLVSLKKQGFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVL
*********KQGFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYERG***************KVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQECLVSLKKQGFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query130 2.2.26 [Sep-21-2011]
Q9VHP0 798 ATP-dependent RNA helicas yes N/A 0.892 0.145 0.777 8e-50
P24346 697 Putative ATP-dependent RN N/A N/A 0.915 0.170 0.644 3e-40
Q62095 658 ATP-dependent RNA helicas yes N/A 0.915 0.180 0.628 7e-40
O00571 662 ATP-dependent RNA helicas yes N/A 0.915 0.179 0.619 1e-39
Q62167 662 ATP-dependent RNA helicas no N/A 0.915 0.179 0.619 1e-39
Q5RF43 658 ATP-dependent RNA helicas no N/A 0.915 0.180 0.628 2e-39
P16381 660 Putative ATP-dependent RN no N/A 0.915 0.180 0.619 2e-39
O15523 660 ATP-dependent RNA helicas no N/A 0.915 0.180 0.628 2e-39
Q6GVM6 660 ATP-dependent RNA helicas yes N/A 0.915 0.180 0.628 3e-39
Q0CLJ6 674 ATP-dependent RNA helicas N/A N/A 0.907 0.175 0.603 4e-37
>sp|Q9VHP0|DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster GN=bel PE=1 SV=1 Back     alignment and function desciption
 Score =  195 bits (495), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 91/117 (77%), Positives = 107/117 (91%), Gaps = 1/117 (0%)

Query: 13  FDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQ 72
           FDD+Q+TEII NN+ALARYDKPTPVQK+AIP+II+GRD+MACAQTGSGKTAAFLVPILNQ
Sbjct: 297 FDDVQLTEIIRNNVALARYDKPTPVQKHAIPIIINGRDLMACAQTGSGKTAAFLVPILNQ 356

Query: 73  MYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVV 129
           MYE G +P P + R Y SR+K +PLGLVLAPTRELATQI++EAKKFAYRS++RP V+
Sbjct: 357 MYELGHVPPPQSTRQY-SRRKQYPLGLVLAPTRELATQIFEEAKKFAYRSRMRPAVL 412




ATP-dependent RNA helicase that is essential and required for cellular function, larval growth, and for male and female fertility. Also required for RNA interference (RNAi), double-stranded RNA induces potent and specific gene silencing, by acting downstream of dsRNA internalization. RNAi is mediated by the RNA-induced silencing complex (RISC), a sequence-specific, multicomponent nuclease that destroys or silences messenger RNAs homologous to the silencing trigger.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|P24346|DDX3_XENLA Putative ATP-dependent RNA helicase an3 OS=Xenopus laevis GN=an3 PE=2 SV=1 Back     alignment and function description
>sp|Q62095|DDX3Y_MOUSE ATP-dependent RNA helicase DDX3Y OS=Mus musculus GN=Ddx3y PE=1 SV=2 Back     alignment and function description
>sp|O00571|DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3 Back     alignment and function description
>sp|Q62167|DDX3X_MOUSE ATP-dependent RNA helicase DDX3X OS=Mus musculus GN=Ddx3x PE=1 SV=3 Back     alignment and function description
>sp|Q5RF43|DDX3Y_PONAB ATP-dependent RNA helicase DDX3Y OS=Pongo abelii GN=DDX3Y PE=2 SV=1 Back     alignment and function description
>sp|P16381|DDX3L_MOUSE Putative ATP-dependent RNA helicase Pl10 OS=Mus musculus GN=D1Pas1 PE=1 SV=1 Back     alignment and function description
>sp|O15523|DDX3Y_HUMAN ATP-dependent RNA helicase DDX3Y OS=Homo sapiens GN=DDX3Y PE=1 SV=2 Back     alignment and function description
>sp|Q6GVM6|DDX3Y_PANTR ATP-dependent RNA helicase DDX3Y OS=Pan troglodytes GN=DDX3Y PE=2 SV=1 Back     alignment and function description
>sp|Q0CLJ6|DED1_ASPTN ATP-dependent RNA helicase ded1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ded1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
195499159 792 bel [Drosophila yakuba] gi|194182931|gb| 0.892 0.146 0.786 2e-48
442618017 801 belle, isoform B [Drosophila melanogaste 0.892 0.144 0.777 4e-48
195330652 797 GM26328 [Drosophila sechellia] gi|194120 0.892 0.145 0.777 5e-48
17985987 798 belle, isoform A [Drosophila melanogaste 0.892 0.145 0.777 6e-48
19528473 798 RE28061p [Drosophila melanogaster] 0.892 0.145 0.777 6e-48
194745552 784 GF16329 [Drosophila ananassae] gi|190628 0.892 0.147 0.777 7e-48
194903791 793 GG17436 [Drosophila erecta] gi|190652642 0.892 0.146 0.777 7e-48
195395963 817 GJ11034 [Drosophila virilis] gi|19414331 0.892 0.141 0.786 1e-47
195452372 802 GK14071 [Drosophila willistoni] gi|19416 0.892 0.144 0.769 2e-47
195054323 799 GH22875 [Drosophila grimshawi] gi|193895 0.892 0.145 0.786 2e-47
>gi|195499159|ref|XP_002096830.1| bel [Drosophila yakuba] gi|194182931|gb|EDW96542.1| bel [Drosophila yakuba] Back     alignment and taxonomy information
 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 92/117 (78%), Positives = 107/117 (91%), Gaps = 1/117 (0%)

Query: 13  FDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQ 72
           FDD+Q+TEII NN+ALARYDKPTPVQKYAIP+II+GRD+MACAQTGSGKTAAFLVPILNQ
Sbjct: 292 FDDVQLTEIIRNNVALARYDKPTPVQKYAIPIIINGRDLMACAQTGSGKTAAFLVPILNQ 351

Query: 73  MYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVV 129
           MYE G +P P + R Y SR+K +PLGLVLAPTRELATQI++EAKKFAYRS++RP V+
Sbjct: 352 MYELGHVPPPQSTRQY-SRRKQYPLGLVLAPTRELATQIFEEAKKFAYRSRMRPAVL 407




Source: Drosophila yakuba

Species: Drosophila yakuba

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|442618017|ref|NP_001262379.1| belle, isoform B [Drosophila melanogaster] gi|440217205|gb|AGB95761.1| belle, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195330652|ref|XP_002032017.1| GM26328 [Drosophila sechellia] gi|194120960|gb|EDW43003.1| GM26328 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|17985987|ref|NP_536783.1| belle, isoform A [Drosophila melanogaster] gi|74947986|sp|Q9VHP0.1|DDX3_DROME RecName: Full=ATP-dependent RNA helicase bel; AltName: Full=Protein belle gi|7299061|gb|AAF54262.1| belle, isoform A [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|19528473|gb|AAL90351.1| RE28061p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194745552|ref|XP_001955251.1| GF16329 [Drosophila ananassae] gi|190628288|gb|EDV43812.1| GF16329 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|194903791|ref|XP_001980939.1| GG17436 [Drosophila erecta] gi|190652642|gb|EDV49897.1| GG17436 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195395963|ref|XP_002056603.1| GJ11034 [Drosophila virilis] gi|194143312|gb|EDW59715.1| GJ11034 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195452372|ref|XP_002073325.1| GK14071 [Drosophila willistoni] gi|194169410|gb|EDW84311.1| GK14071 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195054323|ref|XP_001994075.1| GH22875 [Drosophila grimshawi] gi|193895945|gb|EDV94811.1| GH22875 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
FB|FBgn0263231 798 bel "belle" [Drosophila melano 0.892 0.145 0.777 9.5e-45
UNIPROTKB|F1NIX2 636 DDX3X "Uncharacterized protein 0.915 0.187 0.631 3.1e-35
ZFIN|ZDB-GENE-030131-1565 709 ddx3 "DEAD (Asp-Glu-Ala-Asp) b 0.915 0.167 0.619 6.6e-35
MGI|MGI:1349406 658 Ddx3y "DEAD (Asp-Glu-Ala-Asp) 0.915 0.180 0.628 1.3e-34
UNIPROTKB|F1NIX1 638 DDX3X "Uncharacterized protein 0.915 0.186 0.628 1.5e-34
UNIPROTKB|G5E631 661 DDX3X "Uncharacterized protein 0.915 0.180 0.619 1.7e-34
UNIPROTKB|F1RX16 661 DDX3X "Uncharacterized protein 0.915 0.180 0.619 1.7e-34
UNIPROTKB|J9P0V9 662 DDX3X "Uncharacterized protein 0.915 0.179 0.619 1.7e-34
UNIPROTKB|O00571 662 DDX3X "ATP-dependent RNA helic 0.915 0.179 0.619 1.7e-34
UNIPROTKB|I3LDV0 667 DDX3Y "Uncharacterized protein 0.915 0.178 0.619 1.8e-34
FB|FBgn0263231 bel "belle" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 477 (173.0 bits), Expect = 9.5e-45, P = 9.5e-45
 Identities = 91/117 (77%), Positives = 107/117 (91%)

Query:    13 FDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQ 72
             FDD+Q+TEII NN+ALARYDKPTPVQK+AIP+II+GRD+MACAQTGSGKTAAFLVPILNQ
Sbjct:   297 FDDVQLTEIIRNNVALARYDKPTPVQKHAIPIIINGRDLMACAQTGSGKTAAFLVPILNQ 356

Query:    73 MYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVV 129
             MYE G +P P + R Y SR+K +PLGLVLAPTRELATQI++EAKKFAYRS++RP V+
Sbjct:   357 MYELGHVPPPQSTRQY-SRRKQYPLGLVLAPTRELATQIFEEAKKFAYRSRMRPAVL 412




GO:0007286 "spermatid development" evidence=IMP
GO:0008026 "ATP-dependent helicase activity" evidence=ISS
GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS;IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0043186 "P granule" evidence=IDA
GO:0007283 "spermatogenesis" evidence=IMP
GO:0002168 "instar larval development" evidence=IMP
GO:0048477 "oogenesis" evidence=IMP
GO:0016442 "RNA-induced silencing complex" evidence=IDA
GO:0016246 "RNA interference" evidence=IMP
GO:0005811 "lipid particle" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0043025 "neuronal cell body" evidence=IDA
GO:0010468 "regulation of gene expression" evidence=IMP
GO:0000070 "mitotic sister chromatid segregation" evidence=IMP
UNIPROTKB|F1NIX2 DDX3X "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-1565 ddx3 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1349406 Ddx3y "DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, Y-linked" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NIX1 DDX3X "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G5E631 DDX3X "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RX16 DDX3X "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9P0V9 DDX3X "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O00571 DDX3X "ATP-dependent RNA helicase DDX3X" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LDV0 DDX3Y "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6GVM6DDX3Y_PANTR3, ., 6, ., 4, ., 1, 30.62800.91530.1803yesN/A
Q6CLR3DED1_KLULA3, ., 6, ., 4, ., 1, 30.57260.89230.1850yesN/A
P0CQ74DED1_CRYNJ3, ., 6, ., 4, ., 1, 30.59290.83070.1695yesN/A
Q9VHP0DDX3_DROME3, ., 6, ., 4, ., 1, 30.77770.89230.1453yesN/A
Q6BU54DED1_DEBHA3, ., 6, ., 4, ., 1, 30.56880.83070.1714yesN/A
Q75B50DED1_ASHGO3, ., 6, ., 4, ., 1, 30.58970.88460.1845yesN/A
A2QI25DED1_ASPNC3, ., 6, ., 4, ., 1, 30.55370.90760.1740yesN/A
Q6CB69DED1_YARLI3, ., 6, ., 4, ., 1, 30.60160.90760.1909yesN/A
Q2UGK3DED1_ASPOR3, ., 6, ., 4, ., 1, 30.56190.90760.1748yesN/A
Q8TFK8DED1_CANGA3, ., 6, ., 4, ., 1, 30.55550.89230.1880yesN/A
A3LQ01DED1_PICST3, ., 6, ., 4, ., 1, 30.56250.85380.1715yesN/A
O00571DDX3X_HUMAN3, ., 6, ., 4, ., 1, 30.61980.91530.1797yesN/A
Q4I7K4DED1_GIBZE3, ., 6, ., 4, ., 1, 30.56630.86150.1659yesN/A
O13370DED1_SCHPO3, ., 6, ., 4, ., 1, 30.56750.82300.1682yesN/A
Q54QS3DDX3_DICDI3, ., 6, ., 4, ., 1, 30.52540.88460.1615yesN/A
P24784DBP1_YEAST3, ., 6, ., 4, ., 1, 30.56410.89230.1880yesN/A
Q4WP13DED1_ASPFU3, ., 6, ., 4, ., 1, 30.56190.90760.1750yesN/A
Q62095DDX3Y_MOUSE3, ., 6, ., 4, ., 1, 30.62800.91530.1808yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
cd00268203 cd00268, DEADc, DEAD-box helicases 1e-41
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 5e-34
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 3e-26
PRK10590 456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 2e-23
PRK11192 434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 6e-23
PLN00206 518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 1e-21
smart00487 201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-21
PTZ00110 545 PTZ00110, PTZ00110, helicase; Provisional 1e-19
PRK04837 423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 5e-19
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 3e-18
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 1e-17
PRK11776 460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 1e-15
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 1e-14
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 4e-14
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 9e-14
PRK13767 876 PRK13767, PRK13767, ATP-dependent helicase; Provis 3e-11
PTZ00424 401 PTZ00424, PTZ00424, helicase 45; Provisional 3e-10
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 2e-08
COG1205 851 COG1205, COG1205, Distinct helicase family with a 9e-07
pfam04851100 pfam04851, ResIII, Type III restriction enzyme, re 0.002
COG1061 442 COG1061, SSL2, DNA or RNA helicases of superfamily 0.002
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
 Score =  136 bits (345), Expect = 1e-41
 Identities = 47/117 (40%), Positives = 68/117 (58%), Gaps = 14/117 (11%)

Query: 13  FDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQ 72
           F+++ ++  +   I    ++KPTP+Q  AIP ++SGRDV+  AQTGSGKTAAFL+PIL +
Sbjct: 1   FEELGLSPELLRGIYALGFEKPTPIQARAIPPLLSGRDVIGQAQTGSGKTAAFLIPILEK 60

Query: 73  MYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVV 129
           +        P A              L+LAPTRELA QI + A+K    + L+  V+
Sbjct: 61  LDPSPKKDGPQA--------------LILAPTRELALQIAEVARKLGKHTNLKVVVI 103


A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP- binding region. Length = 203

>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|218292 pfam04851, ResIII, Type III restriction enzyme, res subunit Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
PTZ00110 545 helicase; Provisional 99.95
KOG0330|consensus 476 99.95
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 99.94
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 99.94
KOG0331|consensus 519 99.94
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.94
KOG0340|consensus 442 99.93
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.93
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.93
KOG0346|consensus 569 99.93
KOG0338|consensus 691 99.93
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.92
KOG0334|consensus 997 99.92
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 99.92
KOG0348|consensus 708 99.92
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.92
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 99.91
KOG0345|consensus 567 99.91
KOG0343|consensus 758 99.9
PTZ00424 401 helicase 45; Provisional 99.9
KOG0347|consensus 731 99.9
KOG0335|consensus 482 99.9
KOG0333|consensus 673 99.89
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.89
KOG0342|consensus 543 99.89
KOG0339|consensus 731 99.88
KOG0326|consensus 459 99.88
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.88
KOG0328|consensus 400 99.87
KOG0341|consensus 610 99.87
KOG0337|consensus 529 99.86
KOG0344|consensus 593 99.85
PRK02362 737 ski2-like helicase; Provisional 99.83
KOG0350|consensus 620 99.82
PRK00254 720 ski2-like helicase; Provisional 99.82
KOG0336|consensus 629 99.8
KOG0327|consensus 397 99.79
KOG0329|consensus 387 99.78
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.77
PRK01172 674 ski2-like helicase; Provisional 99.76
PRK13767 876 ATP-dependent helicase; Provisional 99.74
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.73
KOG0332|consensus 477 99.73
KOG4284|consensus 980 99.71
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.69
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 99.67
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 99.66
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.66
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.66
PRK09401 1176 reverse gyrase; Reviewed 99.65
COG1205 851 Distinct helicase family with a unique C-terminal 99.65
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.65
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.64
PRK14701 1638 reverse gyrase; Provisional 99.63
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.63
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.59
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 99.58
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.58
PRK10689 1147 transcription-repair coupling factor; Provisional 99.57
COG1204 766 Superfamily II helicase [General function predicti 99.47
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 99.45
PHA02558 501 uvsW UvsW helicase; Provisional 99.4
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.39
KOG0952|consensus 1230 99.38
COG1202 830 Superfamily II helicase, archaea-specific [General 99.36
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.36
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.35
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.32
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.3
PRK05580 679 primosome assembly protein PriA; Validated 99.3
smart00487 201 DEXDc DEAD-like helicases superfamily. 99.28
smart00489 289 DEXDc3 DEAD-like helicases superfamily. 99.27
smart00488 289 DEXDc2 DEAD-like helicases superfamily. 99.27
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.24
PHA02653 675 RNA helicase NPH-II; Provisional 99.22
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.16
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 99.13
PRK13766 773 Hef nuclease; Provisional 99.12
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.09
KOG0349|consensus 725 99.08
KOG0353|consensus 695 99.04
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.03
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 99.02
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 98.98
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 98.98
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 98.95
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 98.94
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 98.94
PRK12904 830 preprotein translocase subunit SecA; Reviewed 98.94
KOG0354|consensus 746 98.91
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.89
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 98.89
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 98.86
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 98.85
KOG0951|consensus 1674 98.84
PRK13107 908 preprotein translocase subunit SecA; Reviewed 98.83
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 98.8
KOG0352|consensus 641 98.8
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 98.75
PRK09694 878 helicase Cas3; Provisional 98.74
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 98.74
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 98.66
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 98.56
TIGR00595 505 priA primosomal protein N'. All proteins in this f 98.53
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 98.48
PRK12326 764 preprotein translocase subunit SecA; Reviewed 98.46
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 98.42
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.41
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 98.4
KOG0351|consensus 941 98.4
PF1324576 AAA_19: Part of AAA domain 98.35
PF00580 315 UvrD-helicase: UvrD/REP helicase N-terminal domain 98.28
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 98.18
COG1198 730 PriA Primosomal protein N' (replication factor Y) 98.16
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 98.11
KOG1132|consensus 945 98.1
PF07517 266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.1
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 98.08
PF13604 196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.05
TIGR00376 637 DNA helicase, putative. The gene product may repre 98.04
CHL00122 870 secA preprotein translocase subunit SecA; Validate 98.0
KOG0947|consensus 1248 97.99
KOG0948|consensus 1041 97.91
COG4096 875 HsdR Type I site-specific restriction-modification 97.82
KOG1802|consensus 935 97.82
PF02562 205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.79
KOG0951|consensus 1674 97.79
PRK15483 986 type III restriction-modification system StyLTI en 97.74
KOG1803|consensus 649 97.69
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 97.63
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 97.55
KOG0949|consensus 1330 97.55
PF00176 299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 97.52
KOG0950|consensus 1008 97.5
KOG1133|consensus 821 97.46
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 97.44
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 97.43
PRK11054 684 helD DNA helicase IV; Provisional 97.42
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 97.24
PRK10536 262 hypothetical protein; Provisional 97.21
PRK13894319 conjugal transfer ATPase TrbB; Provisional 97.15
COG4889 1518 Predicted helicase [General function prediction on 97.15
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 97.11
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 97.1
PRK10875 615 recD exonuclease V subunit alpha; Provisional 97.08
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 97.07
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 97.07
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 97.05
PRK13889 988 conjugal transfer relaxase TraA; Provisional 96.97
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 96.94
PRK13833323 conjugal transfer protein TrbB; Provisional 96.94
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 96.93
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 96.93
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 96.88
PRK04914 956 ATP-dependent helicase HepA; Validated 96.88
COG2805 353 PilT Tfp pilus assembly protein, pilus retraction 96.84
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 96.8
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 96.79
PRK05298 652 excinuclease ABC subunit B; Provisional 96.79
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.65
TIGR02525 372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 96.6
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 96.57
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.55
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 96.48
COG3587 985 Restriction endonuclease [Defense mechanisms] 96.45
PF12340 229 DUF3638: Protein of unknown function (DUF3638); In 96.39
KOG1131|consensus 755 96.38
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.32
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 96.32
COG3973 747 Superfamily I DNA and RNA helicases [General funct 96.25
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 96.24
PF02534 469 T4SS-DNA_transf: Type IV secretory system Conjugat 96.06
TIGR02524 358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 96.04
KOG2340|consensus 698 96.0
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 95.98
PRK08181269 transposase; Validated 95.97
PRK13851 344 type IV secretion system protein VirB11; Provision 95.96
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 95.94
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 95.88
PRK05973237 replicative DNA helicase; Provisional 95.85
PRK13826 1102 Dtr system oriT relaxase; Provisional 95.84
COG2804 500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 95.84
PRK13764 602 ATPase; Provisional 95.84
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 95.83
cd01126 384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 95.83
PRK14873 665 primosome assembly protein PriA; Provisional 95.79
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 95.72
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 95.72
PRK06921266 hypothetical protein; Provisional 95.71
PRK06526254 transposase; Provisional 95.64
KOG0952|consensus 1230 95.62
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 95.53
PRK13897 606 type IV secretion system component VirD4; Provisio 95.53
PF12846 304 AAA_10: AAA-like domain 95.51
PRK06835329 DNA replication protein DnaC; Validated 95.45
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 95.43
PHA02533 534 17 large terminase protein; Provisional 95.41
cd01129 264 PulE-GspE PulE/GspE The type II secretory pathway 95.41
KOG0744|consensus 423 95.37
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 95.35
smart00382148 AAA ATPases associated with a variety of cellular 95.28
cd01124 187 KaiC KaiC is a circadian clock protein primarily f 95.25
COG1875 436 NYN ribonuclease and ATPase of PhoH family domains 95.24
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 95.23
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 95.23
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 95.18
PRK12377248 putative replication protein; Provisional 95.14
COG0610 962 Type I site-specific restriction-modification syst 95.13
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.1
PRK05707 328 DNA polymerase III subunit delta'; Validated 95.02
PRK13850 670 type IV secretion system protein VirD4; Provisiona 95.0
PF06745 226 KaiC: KaiC; InterPro: IPR014774 This entry represe 94.94
TIGR03877 237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 94.92
PRK10436 462 hypothetical protein; Provisional 94.9
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 94.84
KOG0745|consensus 564 94.82
TIGR02538 564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 94.79
PF10412 386 TrwB_AAD_bind: Type IV secretion-system coupling p 94.72
TIGR02533 486 type_II_gspE general secretory pathway protein E. 94.7
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 94.69
PRK09183259 transposase/IS protein; Provisional 94.67
COG0467 260 RAD55 RecA-superfamily ATPases implicated in signa 94.63
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 94.57
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 94.5
KOG0953|consensus 700 94.5
TIGR01547 396 phage_term_2 phage terminase, large subunit, PBSX 94.48
TIGR02784 1141 addA_alphas double-strand break repair helicase Ad 94.47
cd01127 410 TrwB Bacterial conjugation protein TrwB, ATP bindi 94.46
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 94.44
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 94.41
PRK12723 388 flagellar biosynthesis regulator FlhF; Provisional 94.38
PF1355562 AAA_29: P-loop containing region of AAA domain 94.38
TIGR03881 229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 94.32
cd01122 271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 94.32
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 94.3
PRK07952244 DNA replication protein DnaC; Validated 94.28
COG1419 407 FlhF Flagellar GTP-binding protein [Cell motility 94.24
PF12775 272 AAA_7: P-loop containing dynein motor region D3; P 94.22
PHA02535 581 P terminase ATPase subunit; Provisional 94.21
PF00448 196 SRP54: SRP54-type protein, GTPase domain; InterPro 94.21
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 94.19
KOG0925|consensus 699 94.12
PRK13822 641 conjugal transfer coupling protein TraG; Provision 94.12
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 94.11
PRK13876 663 conjugal transfer coupling protein TraG; Provision 94.09
TIGR03878 259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 94.09
PF04665 241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 94.05
TIGR03743 634 SXT_TraD conjugative coupling factor TraD, SXT/TOL 94.04
PRK12727 559 flagellar biosynthesis regulator FlhF; Provisional 93.98
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 93.96
KOG1805|consensus 1100 93.96
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 93.85
KOG0390|consensus 776 93.83
PF01078 206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 93.83
PF00004132 AAA: ATPase family associated with various cellula 93.79
TIGR02767 623 TraG-Ti Ti-type conjugative transfer system protie 93.7
TIGR01420 343 pilT_fam pilus retraction protein PilT. This model 93.7
PRK05703 424 flhF flagellar biosynthesis regulator FlhF; Valida 93.67
PRK03992 389 proteasome-activating nucleotidase; Provisional 93.65
cd00984 242 DnaB_C DnaB helicase C terminal domain. The hexame 93.65
KOG0989|consensus 346 93.64
cd01131 198 PilT Pilus retraction ATPase PilT. PilT is a nucle 93.52
PRK04328 249 hypothetical protein; Provisional 93.45
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA repl 93.43
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 93.37
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 93.36
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 93.34
TIGR03754 643 conj_TOL_TraD conjugative coupling factor TraD, TO 93.3
PRK08533 230 flagellar accessory protein FlaH; Reviewed 93.28
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 93.19
COG1136 226 SalX ABC-type antimicrobial peptide transport syst 93.17
PRK08699 325 DNA polymerase III subunit delta'; Validated 93.16
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 93.13
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 93.11
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 93.1
TIGR03880 224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 93.08
PRK13880 636 conjugal transfer coupling protein TraG; Provision 93.02
KOG0733|consensus 802 93.01
PRK14721 420 flhF flagellar biosynthesis regulator FlhF; Provis 93.0
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 92.99
COG5008 375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 92.96
PRK08769 319 DNA polymerase III subunit delta'; Validated 92.96
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 92.95
KOG0738|consensus 491 92.95
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 92.95
KOG0920|consensus 924 92.92
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 92.89
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 92.88
TIGR02759 566 TraD_Ftype type IV conjugative transfer system cou 92.79
KOG1533|consensus 290 92.76
PRK13700 732 conjugal transfer protein TraD; Provisional 92.66
PF09439181 SRPRB: Signal recognition particle receptor beta s 92.59
PRK08116268 hypothetical protein; Validated 92.59
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 92.54
PRK06995 484 flhF flagellar biosynthesis regulator FlhF; Valida 92.53
PRK11889 436 flhF flagellar biosynthesis regulator FlhF; Provis 92.42
PRK13531 498 regulatory ATPase RavA; Provisional 92.37
KOG0730|consensus 693 92.34
KOG0733|consensus 802 92.29
PRK06871 325 DNA polymerase III subunit delta'; Validated 92.24
PRK12724 432 flagellar biosynthesis regulator FlhF; Provisional 92.21
PRK08939306 primosomal protein DnaI; Reviewed 92.2
KOG4150|consensus 1034 92.15
KOG0387|consensus 923 92.14
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 92.1
COG4133 209 CcmA ABC-type transport system involved in cytochr 92.09
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 92.05
PRK08903 227 DnaA regulatory inactivator Hda; Validated 92.05
KOG1123|consensus 776 92.02
PRK06067 234 flagellar accessory protein FlaH; Validated 91.93
PRK08727 233 hypothetical protein; Validated 91.92
COG0606 490 Predicted ATPase with chaperone activity [Posttran 91.9
KOG0729|consensus 435 91.89
KOG0926|consensus 1172 91.87
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 91.87
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 91.81
TIGR03744 893 traC_PFL_4706 conjugative transfer ATPase, PFL_470 91.77
CHL00181 287 cbbX CbbX; Provisional 91.75
PHA02244 383 ATPase-like protein 91.73
PRK04296 190 thymidine kinase; Provisional 91.64
KOG1807|consensus 1025 91.54
PRK12402 337 replication factor C small subunit 2; Reviewed 91.51
PRK05642 234 DNA replication initiation factor; Validated 91.43
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 91.4
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 91.39
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 91.35
PF01935 229 DUF87: Domain of unknown function DUF87; InterPro: 91.23
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 91.23
COG3598 402 RepA RecA-family ATPase [DNA replication, recombin 91.21
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 91.18
COG4185 187 Uncharacterized protein conserved in bacteria [Fun 91.16
PRK06090 319 DNA polymerase III subunit delta'; Validated 91.14
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 91.09
PRK10078 186 ribose 1,5-bisphosphokinase; Provisional 91.05
PRK11823 446 DNA repair protein RadA; Provisional 90.93
PRK14974 336 cell division protein FtsY; Provisional 90.85
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 90.78
TIGR02688 449 conserved hypothetical protein TIGR02688. Members 90.76
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 90.74
KOG1806|consensus 1320 90.69
PRK10867 433 signal recognition particle protein; Provisional 90.68
PRK12726 407 flagellar biosynthesis regulator FlhF; Provisional 90.6
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 90.58
COG0714 329 MoxR-like ATPases [General function prediction onl 90.51
PRK14530 215 adenylate kinase; Provisional 90.46
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 90.44
PHA03333 752 putative ATPase subunit of terminase; Provisional 90.37
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 90.34
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 90.33
TIGR00609 1087 recB exodeoxyribonuclease V, beta subunit. All pro 90.33
TIGR02237 209 recomb_radB DNA repair and recombination protein R 90.19
KOG0060|consensus 659 90.13
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 90.11
PRK08084 235 DNA replication initiation factor; Provisional 90.09
PRK13909 910 putative recombination protein RecB; Provisional 90.06
PLN02796 347 D-glycerate 3-kinase 89.99
KOG0924|consensus 1042 89.96
PRK00131175 aroK shikimate kinase; Reviewed 89.96
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 89.93
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 89.93
PRK14729 300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 89.85
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 89.84
PF00308 219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 89.83
PRK08118167 topology modulation protein; Reviewed 89.82
PLN02165 334 adenylate isopentenyltransferase 89.79
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 89.75
KOG0731|consensus 774 89.63
PF07088 484 GvpD: GvpD gas vesicle protein; InterPro: IPR00978 89.51
PRK00300 205 gmk guanylate kinase; Provisional 89.46
PF13654 509 AAA_32: AAA domain; PDB: 3K1J_B. 89.45
COG1126 240 GlnQ ABC-type polar amino acid transport system, A 89.39
cd03115173 SRP The signal recognition particle (SRP) mediates 89.36
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 89.35
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 89.33
PRK07261171 topology modulation protein; Provisional 89.31
PRK06620214 hypothetical protein; Validated 89.27
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 89.26
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 89.22
TIGR00959 428 ffh signal recognition particle protein. This mode 89.22
KOG0652|consensus 424 89.2
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 89.18
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 89.13
PRK07993 334 DNA polymerase III subunit delta'; Validated 89.03
PF00005137 ABC_tran: ABC transporter This structure is on hol 89.01
PF13872 303 AAA_34: P-loop containing NTP hydrolase pore-1 88.91
KOG0736|consensus 953 88.9
PRK14087 450 dnaA chromosomal replication initiation protein; P 88.89
PF03237 384 Terminase_6: Terminase-like family; InterPro: IPR0 88.76
PLN03025 319 replication factor C subunit; Provisional 88.72
COG4604 252 CeuD ABC-type enterochelin transport system, ATPas 88.62
PRK00771 437 signal recognition particle protein Srp54; Provisi 88.61
COG3267 269 ExeA Type II secretory pathway, component ExeA (pr 88.61
PF05729166 NACHT: NACHT domain 88.58
PF03354 477 Terminase_1: Phage Terminase ; InterPro: IPR005021 88.47
TIGR02746 797 TraC-F-type type-IV secretion system protein TraC. 88.47
PRK00411 394 cdc6 cell division control protein 6; Reviewed 88.45
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 88.39
PRK09302 509 circadian clock protein KaiC; Reviewed 88.35
cd01394 218 radB RadB. The archaeal protein radB shares simila 88.32
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 88.27
PF03029 238 ATP_bind_1: Conserved hypothetical ATP binding pro 88.25
KOG0991|consensus 333 88.23
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 88.22
PRK09302 509 circadian clock protein KaiC; Reviewed 88.09
PF13476 202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 88.08
COG3451 796 VirB4 Type IV secretory pathway, VirB4 components 88.04
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 88.04
PRK14088 440 dnaA chromosomal replication initiation protein; P 87.92
KOG0726|consensus 440 87.91
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 87.9
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 87.78
KOG0741|consensus 744 87.78
PRK14531183 adenylate kinase; Provisional 87.72
PF02374 305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 87.64
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 87.63
PRK00149 450 dnaA chromosomal replication initiation protein; R 87.52
PRK00091 307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 87.48
COG1855 604 ATPase (PilT family) [General function prediction 87.41
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 87.38
PRK09361 225 radB DNA repair and recombination protein RadB; Pr 87.25
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 87.18
PRK10876 1181 recB exonuclease V subunit beta; Provisional 87.17
COG1702 348 PhoH Phosphate starvation-inducible protein PhoH, 87.14
PRK06893 229 DNA replication initiation factor; Validated 87.08
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 86.98
CHL00195 489 ycf46 Ycf46; Provisional 86.95
PF14516 331 AAA_35: AAA-like domain 86.95
COG0552 340 FtsY Signal recognition particle GTPase [Intracell 86.93
PRK07399 314 DNA polymerase III subunit delta'; Validated 86.86
TIGR01359 183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 86.83
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 86.83
cd03258 233 ABC_MetN_methionine_transporter MetN (also known a 86.71
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 86.68
PRK04220 301 2-phosphoglycerate kinase; Provisional 86.68
PRK08233182 hypothetical protein; Provisional 86.66
PRK06762166 hypothetical protein; Provisional 86.64
TIGR02012 321 tigrfam_recA protein RecA. This model describes or 86.64
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 86.58
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 86.52
PRK09825176 idnK D-gluconate kinase; Provisional 86.46
PRK10416 318 signal recognition particle-docking protein FtsY; 86.46
TIGR00064 272 ftsY signal recognition particle-docking protein F 86.45
PF00485 194 PRK: Phosphoribulokinase / Uridine kinase family; 86.43
PRK11608 326 pspF phage shock protein operon transcriptional ac 86.42
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 86.4
TIGR02974 329 phageshock_pspF psp operon transcriptional activat 86.37
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 86.37
KOG2373|consensus 514 86.32
PRK05748 448 replicative DNA helicase; Provisional 86.31
KOG0737|consensus 386 86.24
cd03292 214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 86.16
PF00225 335 Kinesin: Kinesin motor domain; InterPro: IPR001752 86.15
TIGR01360 188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 86.11
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 86.1
PRK15177 213 Vi polysaccharide export ATP-binding protein VexC; 86.09
TIGR03608 206 L_ocin_972_ABC putative bacteriocin export ABC tra 86.07
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 86.06
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 86.02
cd01428 194 ADK Adenylate kinase (ADK) catalyzes the reversibl 86.02
PRK13891 852 conjugal transfer protein TrbE; Provisional 85.98
cd03259 213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 85.98
TIGR02673 214 FtsE cell division ATP-binding protein FtsE. This 85.96
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 85.95
KOG0349|consensus 725 85.91
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 85.86
PF02456 369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 85.82
PRK05541176 adenylylsulfate kinase; Provisional 85.8
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 85.78
PRK13873 811 conjugal transfer ATPase TrbE; Provisional 85.75
PRK14532 188 adenylate kinase; Provisional 85.72
PHA00729 226 NTP-binding motif containing protein 85.69
PF03796 259 DnaB_C: DnaB-like helicase C terminal domain; Inte 85.66
cd03255 218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 85.64
PRK10247 225 putative ABC transporter ATP-binding protein YbbL; 85.59
cd03301 213 ABC_MalK_N The N-terminal ATPase domain of the mal 85.57
cd03269 210 ABC_putative_ATPase This subfamily is involved in 85.56
PF1060981 ParA: ParA/MinD ATPase like; InterPro: IPR019591 T 85.53
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 85.52
KOG0732|consensus 1080 85.4
PRK14737186 gmk guanylate kinase; Provisional 85.38
KOG1942|consensus 456 85.38
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 85.34
TIGR02315 243 ABC_phnC phosphonate ABC transporter, ATP-binding 85.34
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 85.31
PRK08356 195 hypothetical protein; Provisional 85.21
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 85.17
cd03293 220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 85.15
cd03262 213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 85.14
PRK01184 184 hypothetical protein; Provisional 85.14
PRK06547172 hypothetical protein; Provisional 85.1
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 85.09
cd00983 325 recA RecA is a bacterial enzyme which has roles in 85.08
cd02023 198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 85.08
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 85.04
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 85.04
PTZ00301 210 uridine kinase; Provisional 85.01
cd03114148 ArgK-like The function of this protein family is u 85.0
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 84.96
PF05496 233 RuvB_N: Holliday junction DNA helicase ruvB N-term 84.95
TIGR00960 216 3a0501s02 Type II (General) Secretory Pathway (IIS 84.95
>PTZ00110 helicase; Provisional Back     alignment and domain information
Probab=99.95  E-value=3.6e-27  Score=184.25  Aligned_cols=118  Identities=37%  Similarity=0.539  Sum_probs=104.8

Q ss_pred             cccccccccCCCcCCCCCHHHHHHHHHCCCCCCcHHHHHHHhHHhcCCcEEEEccCCchHHHHHHHHHHHHHHhcCCCCC
Q psy3307           2 QECLVSLKKQGFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYERGPLPT   81 (130)
Q Consensus         2 ~~~~~~~~~~~f~~l~l~~~i~~~l~~~~~~~~t~~Q~~~i~~~~~g~~~l~~aptGsGKT~~~~l~~l~~~~~~~~~~~   81 (130)
                      ++..+|.|..+|+++++++.++++|.+.||+.||++|.++||.+++|+|++++||||||||++|++|++..+......  
T Consensus       121 ~g~~~p~p~~~f~~~~l~~~l~~~l~~~g~~~pt~iQ~~aip~~l~G~dvI~~ApTGSGKTlaylLP~l~~i~~~~~~--  198 (545)
T PTZ00110        121 AGENVPKPVVSFEYTSFPDYILKSLKNAGFTEPTPIQVQGWPIALSGRDMIGIAETGSGKTLAFLLPAIVHINAQPLL--  198 (545)
T ss_pred             cCCCCCcccCCHhhcCCCHHHHHHHHHCCCCCCCHHHHHHHHHHhcCCCEEEEeCCCChHHHHHHHHHHHHHHhcccc--
Confidence            456789999999999999999999999999999999999999999999999999999999999999999988653211  


Q ss_pred             CCCCCCCCCCCCCCceEEEEcCcHHHHHHHHHHHHHHHhcCCCceEEeC
Q psy3307          82 PPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVL  130 (130)
Q Consensus        82 ~~~~~~~~~~~~~~~~~lil~Pt~~La~q~~~~~~~l~~~~~~~~~~~~  130 (130)
                               ....++++|||+||||||.|+.+.+++++...+++++++|
T Consensus       199 ---------~~~~gp~~LIL~PTreLa~Qi~~~~~~~~~~~~i~~~~~~  238 (545)
T PTZ00110        199 ---------RYGDGPIVLVLAPTRELAEQIREQCNKFGASSKIRNTVAY  238 (545)
T ss_pred             ---------cCCCCcEEEEECChHHHHHHHHHHHHHHhcccCccEEEEe
Confidence                     1122478999999999999999999999999888887764



>KOG0330|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PHA02535 P terminase ATPase subunit; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PRK13822 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK13876 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK13880 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD Back     alignment and domain information
>KOG1533|consensus Back     alignment and domain information
>PRK13700 conjugal transfer protein TraD; Provisional Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR03744 traC_PFL_4706 conjugative transfer ATPase, PFL_4706 family Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG1807|consensus Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>COG4185 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>KOG1806|consensus Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>TIGR00609 recB exodeoxyribonuclease V, beta subunit Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK13909 putative recombination protein RecB; Provisional Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF13654 AAA_32: AAA domain; PDB: 3K1J_B Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>TIGR02746 TraC-F-type type-IV secretion system protein TraC Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>COG3451 VirB4 Type IV secretory pathway, VirB4 components [Intracellular trafficking and secretion] Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK10876 recB exonuclease V subunit beta; Provisional Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>KOG2373|consensus Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK13891 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK13873 conjugal transfer ATPase TrbE; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PF10609 ParA: ParA/MinD ATPase like; InterPro: IPR019591 This entry represents ATPases involved in plasmid partitioning [] Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
2i4i_A 417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 1e-39
1wrb_A 253 Crystal Structure Of The N-Terminal Reca-Like Domai 2e-27
2db3_A 434 Structural Basis For Rna Unwinding By The Dead-Box 2e-23
3dkp_A 245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 8e-15
3ber_A 249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 1e-13
1s2m_A 400 Crystal Structure Of The Dead Box Protein Dhh1p Len 3e-13
2pl3_A 236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 3e-11
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 3e-11
3eiq_A 414 Crystal Structure Of Pdcd4-eif4a Length = 414 6e-11
2zu6_A 388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 7e-11
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 1e-10
3fe2_A 242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 2e-10
1hv8_A 367 Crystal Structure Of A Dead Box Protein From The Hy 2e-10
4a4d_A 253 Crystal Structure Of The N-Terminal Domain Of The H 3e-10
3bor_A 237 Crystal Structure Of The Deadc Domain Of Human Tran 3e-10
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 8e-10
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 1e-09
1qde_A 224 Crystal Structure Of The Atpase Domain Of Translati 1e-09
1fuu_A 394 Yeast Initiation Factor 4a Length = 394 1e-09
2j0q_A 410 The Crystal Structure Of The Exon Junction Complex 2e-09
2hyi_C 413 Structure Of The Human Exon Junction Complex With A 2e-09
2xb2_A 411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 2e-09
2j0u_A 374 The Crystal Structure Of Eif4aiii-Barentsz Complex 2e-09
2hxy_A 391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 2e-09
2vso_A 395 Crystal Structure Of A Translation Initiation Compl 2e-09
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 2e-09
2j0u_B 374 The Crystal Structure Of Eif4aiii-Barentsz Complex 2e-09
1q0u_A 219 Crystal Structure Of The Bstdead N-Terminal Domain 2e-09
2g9n_A 221 Structure Of The Dead Domain Of Human Eukaryotic In 3e-09
1t6n_A 220 Crystal Structure Of The N-Terminal Domain Of Human 1e-08
3ly5_A 262 Ddx18 Dead-Domain Length = 262 4e-08
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 5e-08
3i5x_A 563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 7e-08
3sqx_A 512 Structure Of Mss116p (Nte And C-Tail Double Deletio 9e-08
1xtj_A 386 Structure Of Human Uap56 In Complex With Adp Length 3e-07
1xtk_A 390 Structure Of Decd To Dead Mutation Of Human Uap56 L 3e-07
1xti_A 391 Structure Of Wildtype Human Uap56 Length = 391 8e-07
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 1e-06
2z0m_A 337 Crystal Structure Of Hypothetical Atp-Dependent Rna 1e-06
3pey_A 395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 3e-06
3pew_A 395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 3e-06
3fhc_B 235 Crystal Structure Of Human Dbp5 In Complex With Nup 3e-06
3g0h_A 424 Human Dead-box Rna Helicase Ddx19, In Complex With 3e-06
3fht_A 412 Crystal Structure Of Human Dbp5 In Complex With Amp 3e-06
3ews_A 445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 3e-06
3fmo_B 300 Crystal Structure Of The Nucleoporin Nup214 In Comp 3e-06
3fmp_B 479 Crystal Structure Of The Nucleoporin Nup214 In Comp 3e-06
2oxc_A 230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 4e-06
3fho_B 508 Structure Of S. Pombe Dbp5 Length = 508 2e-05
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure

Iteration: 1

Score = 158 bits (399), Expect = 1e-39, Method: Composition-based stats. Identities = 75/121 (61%), Positives = 94/121 (77%), Gaps = 2/121 (1%) Query: 11 QGFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPIL 70 + F D++M EII NI L RY +PTPVQK+AIP+I RD+MACAQTGSGKTAAFL+PIL Sbjct: 15 ESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPIL 74 Query: 71 NQMYERGPLPTPPAGR--GYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCV 128 +Q+Y GP A + G R+K +P+ LVLAPTRELA QIY+EA+KF+YRS++RPCV Sbjct: 75 SQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCV 134 Query: 129 V 129 V Sbjct: 135 V 135
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 3e-62
1wrb_A 253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 4e-61
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 6e-58
3fe2_A 242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 2e-49
3dkp_A 245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 8e-48
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 2e-42
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 3e-39
2pl3_A 236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 2e-35
3ber_A 249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 2e-33
3ly5_A 262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 3e-33
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 1e-30
1q0u_A 219 Bstdead; DEAD protein, RNA binding protein; 1.85A 1e-30
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 3e-30
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 5e-29
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 2e-27
1t6n_A 220 Probable ATP-dependent RNA helicase; RECA-like fol 2e-27
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 5e-27
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 5e-27
2oxc_A 230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 8e-27
1qde_A 224 EIF4A, translation initiation factor 4A; DEAD box 9e-27
3bor_A 237 Human initiation factor 4A-II; translation initiat 1e-26
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 2e-26
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 3e-26
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 4e-26
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 6e-26
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 6e-26
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 6e-23
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 7e-23
3fmo_B 300 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-22
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 3e-22
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 3e-21
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 3e-07
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 2e-06
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 2e-06
3b6e_A216 Interferon-induced helicase C domain-containing P; 3e-06
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 1e-05
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 2e-05
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 2e-04
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 3e-04
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 4e-04
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 9e-04
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
 Score =  194 bits (496), Expect = 3e-62
 Identities = 75/119 (63%), Positives = 93/119 (78%), Gaps = 2/119 (1%)

Query: 13  FDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQ 72
           F D++M EII  NI L RY +PTPVQK+AIP+I   RD+MACAQTGSGKTAAFL+PIL+Q
Sbjct: 17  FSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQ 76

Query: 73  MYERGPLPTPPAGR--GYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVV 129
           +Y  GP     A +  G   R+K +P+ LVLAPTRELA QIY+EA+KF+YRS++RPCVV
Sbjct: 77  IYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVV 135


>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
3fe2_A 242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.95
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.94
3fmo_B 300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.93
2oxc_A 230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.93
3dkp_A 245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.93
1t6n_A 220 Probable ATP-dependent RNA helicase; RECA-like fol 99.93
3bor_A 237 Human initiation factor 4A-II; translation initiat 99.93
3ber_A 249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.93
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.93
2pl3_A 236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.93
1qde_A 224 EIF4A, translation initiation factor 4A; DEAD box 99.93
1q0u_A 219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.93
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.92
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.92
1wrb_A 253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.92
3ly5_A 262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.91
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.9
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.9
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.89
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.89
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.89
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.88
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.88
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.88
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.88
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.86
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.85
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.84
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 99.82
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.79
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.78
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.77
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 99.77
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.76
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.76
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.74
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.73
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.72
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 99.71
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 99.7
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.69
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 99.68
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 99.67
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.66
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.65
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.65
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.65
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.64
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.64
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.63
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.6
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.59
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.56
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.56
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.55
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.55
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.52
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.51
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.51
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.51
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.5
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.48
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.47
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.46
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.44
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.42
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.38
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.36
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.33
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.32
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.3
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.23
3h1t_A 590 Type I site-specific restriction-modification syst 99.15
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.08
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.04
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.04
3jux_A 822 Protein translocase subunit SECA; protein transloc 98.95
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 98.81
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.77
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 98.69
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 98.41
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 98.36
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 98.19
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 98.08
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 98.07
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 97.92
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 97.92
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.78
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.76
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 97.67
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 97.62
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 97.48
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 97.46
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 97.21
2o0j_A 385 Terminase, DNA packaging protein GP17; nucleotide- 97.13
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 96.91
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 96.32
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.29
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.25
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 96.09
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 95.46
3co5_A143 Putative two-component system transcriptional RES 95.36
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 95.32
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 95.19
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 95.17
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 95.11
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.1
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 95.01
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 94.9
2eyu_A 261 Twitching motility protein PILT; pilus retraction 94.77
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 94.55
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 94.32
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 94.28
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 94.19
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.15
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 94.09
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 94.01
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 94.0
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 93.94
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 93.74
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 93.71
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 93.45
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 93.4
3b85_A 208 Phosphate starvation-inducible protein; PHOH2, ATP 93.39
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 93.33
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 93.22
1tue_A212 Replication protein E1; helicase, replication, E1E 93.17
2r44_A 331 Uncharacterized protein; putative ATPase, structur 93.17
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 93.14
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 93.12
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 93.01
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 92.98
3hjh_A 483 Transcription-repair-coupling factor; MFD, mutatio 92.87
3bos_A 242 Putative DNA replication factor; P-loop containing 92.81
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 92.79
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 92.74
2qgz_A308 Helicase loader, putative primosome component; str 92.66
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 92.5
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 92.47
1lvg_A 198 Guanylate kinase, GMP kinase; transferase; HET: AD 92.38
2gza_A 361 Type IV secretion system protein VIRB11; ATPase, h 92.34
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 92.32
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 92.31
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 92.28
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 92.22
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 92.1
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 91.79
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 91.74
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 91.63
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 91.63
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 91.63
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 91.51
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 91.5
3vaa_A199 Shikimate kinase, SK; structural genomics, center 91.41
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 91.35
2ewv_A 372 Twitching motility protein PILT; pilus retraction 91.33
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 91.23
1w36_B 1180 RECB, exodeoxyribonuclease V beta chain; recombina 91.17
3tr0_A 205 Guanylate kinase, GMP kinase; purines, pyrimidines 91.15
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 91.13
2j41_A 207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 91.1
2b8t_A 223 Thymidine kinase; deoxyribonucleoside kinase, zinc 90.7
2chg_A 226 Replication factor C small subunit; DNA-binding pr 90.65
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 90.64
1p9r_A 418 General secretion pathway protein E; bacterial typ 90.63
1kag_A173 SKI, shikimate kinase I; transferase, structural g 90.58
1z6g_A 218 Guanylate kinase; structural genomics, SGC, struct 90.55
3a00_A 186 Guanylate kinase, GMP kinase; domain movement, dim 90.55
1znw_A 207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 90.55
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 90.45
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 90.43
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 90.4
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 90.4
1xx6_A 191 Thymidine kinase; NESG, northeast structural genom 90.4
2qor_A 204 Guanylate kinase; phosphotransferase, purine metab 90.39
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 90.34
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 90.16
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 90.08
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 90.08
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 90.02
1s96_A 219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 90.01
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 89.95
1ex7_A 186 Guanylate kinase; substrate-induced FIT, domain mo 89.87
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 89.85
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 89.79
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 89.67
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 89.65
3c8u_A 208 Fructokinase; YP_612366.1, putative fructose trans 89.57
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 89.53
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 89.51
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 89.49
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 89.42
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 89.32
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 89.31
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 89.31
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 89.21
1kht_A 192 Adenylate kinase; phosphotransferase, signaling pr 89.16
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 89.15
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 88.99
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 88.85
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 88.84
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 88.75
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 88.71
1rj9_A 304 FTSY, signal recognition protein; SRP-GTPase domai 88.68
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 88.55
3u4q_B 1166 ATP-dependent helicase/deoxyribonuclease subunit; 88.54
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 88.48
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 88.45
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 88.33
2i3b_A 189 HCR-ntpase, human cancer-related ntpase; AAA, ross 88.32
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 88.2
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 88.16
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 88.06
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 88.05
2bdt_A 189 BH3686; alpha-beta protein, structural genomics, P 87.96
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 87.8
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 87.71
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 87.58
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 87.48
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 87.46
2cvh_A 220 DNA repair and recombination protein RADB; filamen 87.38
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 87.33
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 87.29
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 87.28
2rhm_A 193 Putative kinase; P-loop containing nucleoside trip 87.24
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 87.2
2px0_A 296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 87.14
3nwn_A 359 Kinesin-like protein KIF9; motor domain, ADP, stru 87.1
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 87.04
2chq_A 319 Replication factor C small subunit; DNA-binding pr 87.03
3t61_A 202 Gluconokinase; PSI-biology, structural genomics, p 86.95
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 86.92
4a74_A 231 DNA repair and recombination protein RADA; hydrola 86.88
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 86.86
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 86.85
2r2a_A 199 Uncharacterized protein; zonular occludens toxin, 86.78
1bg2_A 325 Kinesin; motor protein, ATPase, microtubule associ 86.78
3asz_A 211 Uridine kinase; cytidine phosphorylation, transfer 86.72
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 86.68
1u94_A 356 RECA protein, recombinase A; homologous recombinat 86.68
1ry6_A 360 Internal kinesin; kinesin motor domain, nucleotide 86.65
1m7g_A 211 Adenylylsulfate kinase; APS kinase, transferase, s 86.43
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 86.42
3dc4_A 344 Kinesin-like protein NOD; catalytic domain, ATPase 86.34
2v54_A 204 DTMP kinase, thymidylate kinase; nucleotide biosyn 86.28
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 86.26
1tev_A 196 UMP-CMP kinase; ploop, NMP binding region, LID reg 86.25
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 86.22
2c95_A 196 Adenylate kinase 1; transferase, AP4A, nucleotide 86.19
2bwj_A 199 Adenylate kinase 5; phosphoryl transfer reaction, 86.18
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 86.14
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 86.11
1sgw_A214 Putative ABC transporter; structural genomics, P p 86.09
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 86.05
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 85.73
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 85.7
4a14_A 344 Kinesin, kinesin-like protein KIF7; motor protein, 85.67
1goj_A 355 Kinesin, kinesin heavy chain; motor protein, ATPas 85.66
3b6u_A 372 Kinesin-like protein KIF3B; structural genomics co 85.61
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 85.61
2y65_A 365 Kinesin, kinesin heavy chain; motor protein; HET: 85.57
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 85.57
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 85.52
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 85.5
2vvg_A 350 Kinesin-2; motor protein, nucleotide-binding, micr 85.49
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 85.47
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 85.45
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 85.42
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 85.4
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 85.37
2h58_A 330 Kinesin-like protein KIFC3 variant; motor domain, 85.31
1xp8_A 366 RECA protein, recombinase A; recombination, radior 85.31
2zfi_A 366 Kinesin-like protein KIF1A, kinesin heavy chain is 85.31
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 85.31
1t5c_A 349 CENP-E protein, centromeric protein E; kinesin mot 85.3
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 85.29
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 85.29
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 85.28
3t0q_A 349 AGR253WP; kinesin, alpha and beta proteins, P-loop 85.28
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 85.25
1g6h_A 257 High-affinity branched-chain amino acid transport 85.23
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 85.19
3cob_A 369 Kinesin heavy chain-like protein; motor, switch II 85.17
1nks_A 194 Adenylate kinase; thermophilic, transferase; HET: 85.17
1via_A175 Shikimate kinase; structural genomics, transferase 85.11
3pvs_A 447 Replication-associated recombination protein A; ma 85.11
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 85.09
1x88_A 359 Kinesin-like protein KIF11; switch II, motor domai 85.08
3gbj_A 354 KIF13B protein; kinesin, motor domain, ADP, struct 85.05
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 85.05
1ji0_A 240 ABC transporter; ATP binding protein, structural g 85.03
1f9v_A 347 Kinesin-like protein KAR3; kinesin-related protein 84.98
2nr8_A 358 Kinesin-like protein KIF9; motor domain, ADP, stru 84.98
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 84.96
3kta_A182 Chromosome segregation protein SMC; structural mai 84.92
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 84.9
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 84.89
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 84.88
2z43_A 324 DNA repair and recombination protein RADA; archaea 84.87
1v8k_A 410 Kinesin-like protein KIF2C; microtubule destabiliz 84.86
3u06_A 412 Protein claret segregational; motor domain, stalk 84.86
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 84.85
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 84.83
3fb4_A 216 Adenylate kinase; psychrophIle, phosphotransferase 84.81
3lre_A 355 Kinesin-like protein KIF18A; motor protein, nucleo 84.8
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 84.78
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 84.77
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 84.69
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 84.67
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 84.66
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 84.66
2ghi_A 260 Transport protein; multidrug resistance protein, M 84.65
1b0u_A 262 Histidine permease; ABC transporter, transport pro 84.6
2plr_A 213 DTMP kinase, probable thymidylate kinase; TMP-bind 84.59
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 84.59
2og2_A 359 Putative signal recognition particle receptor; nuc 84.53
2wwf_A 212 Thymidilate kinase, putative; transferase, malaria 84.52
2wbe_C 373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 84.42
2qt1_A 207 Nicotinamide riboside kinase 1; non-protein kinase 84.4
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 84.38
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 84.38
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 84.36
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 84.32
1nn5_A 215 Similar to deoxythymidylate kinase (thymidylate K; 84.24
3dl0_A 216 Adenylate kinase; phosphotransferase, zinc coordin 84.22
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 84.18
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 84.16
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 84.15
2heh_A 387 KIF2C protein; kinesin, motor domain, ADP, structu 84.12
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 84.07
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 84.0
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 83.92
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 83.91
2iut_A 574 DNA translocase FTSK; nucleotide-binding, chromoso 83.9
3be4_A 217 Adenylate kinase; malaria, cryptosporidium parvum 83.87
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 83.87
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 83.84
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 83.84
1qf9_A 194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 83.77
2if2_A 204 Dephospho-COA kinase; alpha-beta protein, structur 83.65
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 83.6
1xjc_A169 MOBB protein homolog; structural genomics, midwest 83.52
3bfn_A 388 Kinesin-like protein KIF22; limited proteolysis, s 83.5
2r6a_A 454 DNAB helicase, replicative helicase; replication, 83.5
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 83.5
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 83.49
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 83.46
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 83.41
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 83.41
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 83.37
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 83.3
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 83.2
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 83.19
2j9r_A 214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 83.13
2vli_A183 Antibiotic resistance protein; transferase, tunica 83.13
2owm_A 443 Nckin3-434, related to kinesin-like protein KIF1C; 83.02
1jjv_A 206 Dephospho-COA kinase; P-loop nucleotide-binding fo 82.94
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 82.75
1ukz_A 203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 82.74
2rep_A 376 Kinesin-like protein KIFC1; structural genomics co 82.68
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 82.68
2jaq_A 205 Deoxyguanosine kinase; transferase, deoxyribonucle 82.59
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 82.31
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 82.29
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 82.27
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 82.26
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 82.01
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 81.92
3auy_A 371 DNA double-strand break repair RAD50 ATPase; DNA r 81.79
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 81.76
3sr0_A 206 Adenylate kinase; phosphoryl transfer analogue, AL 81.72
2r8r_A 228 Sensor protein; KDPD, PFAM02702, MCSG, structural 81.52
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 81.5
2pbr_A 195 DTMP kinase, thymidylate kinase; transferase, nucl 81.49
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 81.45
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 81.44
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 81.42
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 81.15
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 81.07
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 80.98
1e4v_A 214 Adenylate kinase; transferase(phosphotransferase); 80.75
2z0h_A 197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 80.64
4h1g_A 715 Maltose binding protein-cakar3 motor domain fusio; 80.51
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 80.48
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 80.48
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 80.47
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 80.02
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
Probab=99.95  E-value=7.1e-27  Score=164.57  Aligned_cols=118  Identities=31%  Similarity=0.459  Sum_probs=104.6

Q ss_pred             cccccccccCCCcCCCCCHHHHHHHHHCCCCCCcHHHHHHHhHHhcCCcEEEEccCCchHHHHHHHHHHHHHHhcCCCCC
Q psy3307           2 QECLVSLKKQGFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYERGPLPT   81 (130)
Q Consensus         2 ~~~~~~~~~~~f~~l~l~~~i~~~l~~~~~~~~t~~Q~~~i~~~~~g~~~l~~aptGsGKT~~~~l~~l~~~~~~~~~~~   81 (130)
                      ++...|.+..+|+++++++.+++++.+.||..|+++|.++|+.+++|+|+++++|||||||++|++|++..+......  
T Consensus        20 ~~~~~p~~~~~f~~~~l~~~l~~~l~~~g~~~~~~~Q~~~i~~~~~g~~~l~~apTGsGKT~~~~l~~l~~l~~~~~~--   97 (242)
T 3fe2_A           20 RGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFL--   97 (242)
T ss_dssp             ESSCCCCCCSSTTTTTCCHHHHHHHHTTTCCSCCHHHHHHHHHHHHTCCEEEEECTTSCHHHHHHHHHHHHHHTSCCC--
T ss_pred             eCCCCCCccCCHhhcCCCHHHHHHHHHCCCCCCCHHHHHHHHHHhCCCCEEEECCCcCHHHHHHHHHHHHHHHhcccc--
Confidence            456788999999999999999999999999999999999999999999999999999999999999999998754321  


Q ss_pred             CCCCCCCCCCCCCCceEEEEcCcHHHHHHHHHHHHHHHhcCCCceEEeC
Q psy3307          82 PPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVL  130 (130)
Q Consensus        82 ~~~~~~~~~~~~~~~~~lil~Pt~~La~q~~~~~~~l~~~~~~~~~~~~  130 (130)
                               ....++++||++||++|+.|+.+.++++....++++.+++
T Consensus        98 ---------~~~~~~~~lil~Pt~~L~~Q~~~~~~~~~~~~~~~~~~~~  137 (242)
T 3fe2_A           98 ---------ERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIY  137 (242)
T ss_dssp             ---------CTTCCCSEEEECSSHHHHHHHHHHHHHHHHHTTCCEEEEC
T ss_pred             ---------ccCCCCEEEEEeCcHHHHHHHHHHHHHHHhhcCceEEEEE
Confidence                     1122378999999999999999999999999888877653



>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 130
d1wrba1 238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 7e-18
d1gkub1 237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 1e-15
d2g9na1 218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 1e-14
d2j0sa1 222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 3e-14
d2bmfa2 305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 4e-14
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 1e-13
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 2e-13
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 2e-12
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 2e-12
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 1e-11
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 4e-11
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 5e-11
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 2e-08
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 4e-06
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: putative ATP-dependent RNA helicase VlgB
species: Flatworm (Dugesia japonica) [TaxId: 6161]
 Score = 74.2 bits (181), Expect = 7e-18
 Identities = 59/117 (50%), Positives = 78/117 (66%), Gaps = 7/117 (5%)

Query: 13  FDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQ 72
           FD++++   I NNI LA Y +PTP+QK AIP I+  RD+MACAQTGSGKTAAFL+PI+N 
Sbjct: 23  FDELKLDPTIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINH 82

Query: 73  MYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVV 129
           +  +       +       K  +P  L+LAPTRELA QI  E++KF+  + LR CVV
Sbjct: 83  LVCQDLNQQRYS-------KTAYPKCLILAPTRELAIQILSESQKFSLNTPLRSCVV 132


>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d2j0sa1 222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.97
d2g9na1 218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.97
d1wrba1 238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.97
d1t6na_ 207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.96
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.96
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.96
d1hv8a1 208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.94
d1s2ma1 206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.94
d1q0ua_ 209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.92
d1gkub1 237 Helicase-like "domain" of reverse gyrase {Archaeon 99.84
d1oywa2 206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.81
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.79
d1wp9a1 200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.63
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.4
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.39
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.36
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.29
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.21
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.02
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 98.69
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 98.36
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 98.15
d1z63a1 230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 97.84
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.8
d1tf5a3 273 Translocation ATPase SecA, nucleotide-binding doma 97.77
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 97.74
d1z3ix2 298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 97.63
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 97.48
d1nkta3 288 Translocation ATPase SecA, nucleotide-binding doma 97.29
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.51
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 96.49
d2i3ba1 189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.84
d1vmaa2 213 GTPase domain of the signal recognition particle r 95.63
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 95.52
d2qy9a2 211 GTPase domain of the signal recognition particle r 95.49
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 95.46
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 95.42
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 95.27
d1ls1a2 207 GTPase domain of the signal sequence recognition p 95.25
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 95.09
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 94.97
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 94.92
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 94.77
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 94.75
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 94.7
d1j8yf2 211 GTPase domain of the signal sequence recognition p 94.69
d1a5ta2 207 delta prime subunit of DNA polymerase III, N-domai 94.55
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 94.49
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 94.46
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.45
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 94.43
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.42
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 94.15
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 93.95
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 93.9
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 93.83
d1lw7a2 192 Transcriptional regulator NadR, ribosylnicotinamid 93.77
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 93.45
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 93.41
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 93.27
d2gnoa2 198 gamma subunit of DNA polymerase III, N-domain {The 93.22
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 93.19
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.19
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 93.16
d1okkd2 207 GTPase domain of the signal recognition particle r 93.15
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 93.01
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 92.9
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 92.46
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 92.36
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 92.34
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 92.21
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 92.08
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 91.98
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 91.92
d1ak2a1 190 Adenylate kinase {Cow (Bos taurus), mitochondrial 91.92
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 91.82
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 91.65
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 91.52
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 91.44
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 91.24
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 91.16
d1gkya_ 186 Guanylate kinase {Baker's yeast (Saccharomyces cer 91.13
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 91.05
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 90.96
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 90.37
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 90.34
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 90.23
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 90.23
d1zaka1 189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 90.12
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 90.1
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 90.09
d1goja_ 354 Kinesin {Neurospora crassa [TaxId: 5141]} 89.96
d1lvga_ 190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 89.8
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 89.79
d1bg2a_ 323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 89.32
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 89.25
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 89.25
d1qf9a_ 194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 89.13
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 89.08
d1ukza_ 196 Uridylate kinase {Baker's yeast (Saccharomyces cer 89.04
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 89.0
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 88.94
d1khta_ 190 Adenylate kinase {Archaeon Methanococcus voltae [T 88.92
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 88.62
d1s96a_ 205 Guanylate kinase {Escherichia coli [TaxId: 562]} 88.6
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 88.59
d3adka_ 194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 88.53
d2ak3a1 189 Adenylate kinase {Cow (Bos taurus), mitochondrial 88.32
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 87.76
d1teva_ 194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 87.63
d1tuea_205 Replication protein E1 helicase domain {Human papi 87.51
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 87.49
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 87.49
d1v8ka_ 362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 87.38
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 87.13
d1nksa_ 194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 86.59
d1x88a1 345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 86.57
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 86.54
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 86.51
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 86.47
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 86.4
d1sdma_ 364 Kinesin heavy chain-like protein {Potato (Solanum 86.22
d2ncda_ 368 Kinesin motor Ncd (non-claret disjunctional) {Frui 86.05
d2zfia1 349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 85.67
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 85.65
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 85.22
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 84.74
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 84.72
d1f9va_ 342 Kinesin motor Ncd (non-claret disjunctional) {Bake 84.58
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 84.39
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 84.35
d1uj2a_ 213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 84.07
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 83.94
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 83.86
d1qhla_ 222 Cell division protein MukB {Escherichia coli [TaxI 83.86
d2awna2 232 Maltose transport protein MalK, N-terminal domain 83.84
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 83.65
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 83.55
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 83.42
d3d31a2 229 Sulfate/molybdate ABC transporter, ATP-binding pro 83.23
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 83.19
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 83.05
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 82.69
d1g2912 240 Maltose transport protein MalK, N-terminal domain 82.67
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 82.3
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 82.26
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 82.17
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 81.9
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 81.75
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 81.64
d4tmka_ 210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 81.47
d1ry6a_ 330 Kinesin {Malaria parasite (Plasmodium falciparum) 80.62
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 80.61
d1l7vc_ 231 ABC transporter involved in vitamin B12 uptake, Bt 80.5
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 80.24
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 80.07
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=1.9e-31  Score=185.09  Aligned_cols=107  Identities=33%  Similarity=0.434  Sum_probs=98.2

Q ss_pred             cccCCCcCCCCCHHHHHHHHHCCCCCCcHHHHHHHhHHhcCCcEEEEccCCchHHHHHHHHHHHHHHhcCCCCCCCCCCC
Q psy3307           8 LKKQGFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYERGPLPTPPAGRG   87 (130)
Q Consensus         8 ~~~~~f~~l~l~~~i~~~l~~~~~~~~t~~Q~~~i~~~~~g~~~l~~aptGsGKT~~~~l~~l~~~~~~~~~~~~~~~~~   87 (130)
                      ....+|++|+|++.++++|+++||+.|||+|.++||.+++|+|++++||||||||+||++|+++++.....         
T Consensus        14 ~~~~sF~~l~L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~~~---------   84 (222)
T d2j0sa1          14 DVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVR---------   84 (222)
T ss_dssp             CCCCSGGGGCCCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTTSC---------
T ss_pred             CCCCCHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhccccccccccccc---------
Confidence            44568999999999999999999999999999999999999999999999999999999999998754432         


Q ss_pred             CCCCCCCCceEEEEcCcHHHHHHHHHHHHHHHhcCCCceEEeC
Q psy3307          88 YPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVL  130 (130)
Q Consensus        88 ~~~~~~~~~~~lil~Pt~~La~q~~~~~~~l~~~~~~~~~~~~  130 (130)
                             .++++|++|||||+.|+++.+++++++.++++.+++
T Consensus        85 -------~~~~lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~  120 (222)
T d2j0sa1          85 -------ETQALILAPTRELAVQIQKGLLALGDYMNVQCHACI  120 (222)
T ss_dssp             -------SCCEEEECSSHHHHHHHHHHHHHHTTTTTCCEEEEC
T ss_pred             -------CceeEEecchHHHHHHHHHHHHHHhCccceeEEEEe
Confidence                   278999999999999999999999999999988764



>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure