Diaphorina citri psyllid: psy3312


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MDSIEKKQPIDIPDKPDYLISQRYLIGLLGFLAFALTYVQRFCLSMAITEMAHTEHKVSNKSLQCPVPVLIRNQTVNKHYEFDWDERTQGLILSSFFWGYVLNHIPGALIAERYGGKYVLGFGLLVSTLATLATPLAARSFGAVGILCARFIVGLGQGPAYPSMNVILAQWVPKTERGRMGALVFAGSY
cccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcEEEEHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHcccc
**************KPDYLISQRYLIGLLGFLAFALTYVQRFCLSMAITEMAHTEHKVSNKSL***********TVNKHYEFDWDERTQGLILSSFFWGYVLNHIPGALIAERYGGKYVLGFGLLVSTLATLATPLAARSFGAVGILCARFIVGLGQGPAYPSMNVILAQWVPKTERGRMGALVFAGSY
xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSIEKKQPIDIPDKPDYLISQRYLIGLLGFLAFALTYVQRFCLSMAITEMAHTEHKVSNKSLQCPVPVLIRNQTVNKHYEFDWDERTQGLILSSFFWGYVLNHIPGALIAERYGGKYVLGFGLLVSTLATLATPLAARSFGAVGILCARFIVGLGQGPAYPSMNVILAQWVPKTERGRMGALVFAGSY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0005315 [MF]inorganic phosphate transmembrane transporter activityprobableGO:0015291, GO:0005215, GO:1901677, GO:0022857, GO:0003674, GO:0022804
GO:0031090 [CC]organelle membraneprobableGO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0046942 [BP]carboxylic acid transportprobableGO:0015849, GO:0006811, GO:0006810, GO:0006820, GO:0015711, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0009536 [CC]plastidprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0015114 [MF]phosphate ion transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0015103
GO:0046943 [MF]carboxylic acid transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PW4, chain A
Confidence level:confident
Coverage over the Query: 21-52,80-187
View the alignment between query and template
View the model in PyMOL