Diaphorina citri psyllid: psy3317


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MKSSMSSSLTISSDMASSSLTVSSEMDSCSDLDKRSSSSSLSSHDENKVVRRKSSTRRSSQSRASYPMSGDQSFDDVTLPEWVCIGESVLIRPYNSSGVIAYIGPTEFAAGTWVGVELDAPTGKNDGTVQGTRYFESRPKHGIFVRADKLIQDRRGRAMRSGGTGAMRRSTSR
ccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccEEEEcccccCEEEEEEECcccccccEEEEEEcccccccccEEccEEEECcccccEEEECcccEEEccccccccccccccccccccc
********************************************************************************EWVCIGESVLIRPYNSSGVIAYIGPTEFAAGTWVGVELDAPTGKNDGTVQGTRYFESRPKHGIFVRADKL***********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSSMSSSLTISSDMASSSLTVSSEMDSCSDLDKRSSSSSLSSHDENKVVRRKSSTRRSSQSRASYPMSGDQSFDDVTLPEWVCIGESVLIRPYNSSGVIAYIGPTEFAAGTWVGVELDAPTGKNDGTVQGTRYFESRPKHGIFVRADKLIQDRRGRAMRSGGTGAMRRSTSR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000235 [CC]astral microtubuleprobableGO:0043229, GO:0043228, GO:0005874, GO:0043226, GO:0005876, GO:0005737, GO:0044446, GO:0005818, GO:0005819, GO:0044430, GO:0005856, GO:0015630, GO:0005881, GO:0043234, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044422
GO:0005769 [CC]early endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0035371 [CC]microtubule plus endprobableGO:0005856, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2COW, chain A
Confidence level:very confident
Coverage over the Query: 76-156
View the alignment between query and template
View the model in PyMOL