Psyllid ID: psy3317

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MKSSMSSSLTISSDMASSSLTVSSEMDSCSDLDKRSSSSSLSSHDENKVVRRKSSTRRSSQSRASYPMSGDQSFDDVTLPEWVCIGESVLIRPYNSSGVIAYIGPTEFAAGTWVGVELDAPTGKNDGTVQGTRYFESRPKHGIFVRADKLIQDRRGRAMRSGGTGAMRRSTSR
cccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccEEEEcccccEEEEEEEEEcccccccEEEEEEcccccccccEEccEEEEEcccccEEEEEcccEEEccccccccccccccccccccc
ccccccccccccccccccccccccccccccccccccccHHHHccccccHHHHHccccccccccccccccccccccccccccccEEccEEEEccccccEEEEEEEccccccccEEEEEEccccccEccEEccEEccccccccEEEEccccEEEccccccccccccccccccccc
mkssmsssltissdmasssltvssemdscsdldkrssssslsshdenkvvrrksstrrssqsrasypmsgdqsfddvtlpewvcigesvlirpynssgviayigptefaagtwvgveldaptgkndgtvqgtryfesrpkhgifvrADKLIQDRrgramrsggtgamrrstsr
mkssmsssltissdmassslTVSSEMDSCSDLDkrssssslsshdenkvvrrksstrrssqsrasypmsgdqsfddVTLPEWVCIGESVLIRPYNSSGVIAYIGPTEFAAGTWVGVELDAPTGKNDGTVQGtryfesrpkhgifvradkliqdrrgramrsggtgamrrstsr
mkssmsssltissdmasssLTVSSEMdscsdldkrssssslsshdENKVVrrksstrrssqsrasYPMSGDQSFDDVTLPEWVCIGESVLIRPYNSSGVIAYIGPTEFAAGTWVGVELDAPTGKNDGTVQGTRYFESRPKHGIFVRADKLIQDRRGRAMRSGGTGAMRRSTSR
**************************************************************************DDVTLPEWVCIGESVLIRPYNSSGVIAYIGPTEFAAGTWVGVELDAPTGKNDGTVQGTRYFESRPKHGIFVRADKL***********************
**********************************************************************************VCIGESVLIRPYNSSGVIAYIGPTEFAAGTWVGVELDAPTGKNDGTVQGTRYFESRPKHGIFVRA**************************
************************************************************************SFDDVTLPEWVCIGESVLIRPYNSSGVIAYIGPTEFAAGTWVGVELDAPTGKNDGTVQGTRYFESRPKHGIFVRADKLIQDR*******************
********************************************************************************EWVCIGESVLIRPYNSSGVIAYIGPTEFAAGTWVGVELDAPTGKNDGTVQGTRYFESRPKHGIFVRADKLIQD********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSSMSSSLTISSDMASSSLTVSSEMDSCSDLDKRSSSSSLSSHDENKVVRRKSSTRRSSQSRASYPMSGDQSFDDVTLPEWVCIGESVLIRPYNSSGVIAYIGPTEFAAGTWVGVELDAPTGKNDGTVQGTRYFESRPKHGIFVRADKLIQDRRGRAMRSGGTGAMRRSTSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query173 2.2.26 [Sep-21-2011]
Q9NQT81826 Kinesin-like protein KIF1 yes N/A 0.630 0.059 0.379 1e-16
Q5VT06 3117 Centrosome-associated pro no N/A 0.774 0.042 0.357 1e-14
Q8N3C7705 CAP-Gly domain-containing no N/A 0.641 0.157 0.361 1e-13
Q01397 1367 Dynactin, 150 kDa isoform N/A N/A 0.369 0.046 0.492 2e-13
Q5R686547 CAP-Gly domain-containing no N/A 0.375 0.118 0.454 6e-13
Q96DZ5547 CAP-Gly domain-containing no N/A 0.375 0.118 0.454 6e-13
Q9VJE5 1690 Restin homolog OS=Drosoph no N/A 0.433 0.044 0.48 1e-12
Q20728229 Tubulin-specific chaperon yes N/A 0.283 0.213 0.591 2e-12
Q54Z01270 Tubulin-specific chaperon no N/A 0.312 0.2 0.481 3e-12
O55156 1046 CAP-Gly domain-containing no N/A 0.543 0.089 0.424 3e-12
>sp|Q9NQT8|KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens GN=KIF13B PE=1 SV=1 Back     alignment and function desciption
 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 70/124 (56%), Gaps = 15/124 (12%)

Query: 60   SQSRASYPMSGDQSF-------DDVTLPEWVCIGESVLIRPYNSSGVIAYIGPTEFAAGT 112
            ++  A  P +G Q+        D+V  PEW+  GE V +  +  +GV+ Y+GP +F  GT
Sbjct: 1673 AEGNAPAPGAGGQALASDSEEADEV--PEWLREGEFVTVGAH-KTGVVRYVGPADFQEGT 1729

Query: 113  WVGVELDAPTGKNDGTVQGTRYFESRPKHGIFVRADKLIQD-----RRGRAMRSGGTGAM 167
            WVGVELD P+GKNDG++ G +YF   P +G+ VR  ++ +      RR   +R G   A 
Sbjct: 1730 WVGVELDLPSGKNDGSIGGKQYFRCNPGYGLLVRPSRVRRATGPVRRRSTGLRLGAPEAR 1789

Query: 168  RRST 171
            R +T
Sbjct: 1790 RSAT 1793
Involved in reorganization of the cortical cytoskeleton. Regulates axon formation by promoting the formation of extra axons. May be functionally important for the intracellular trafficking of MAGUKs and associated protein complexes.
Homo sapiens (taxid: 9606)
>sp|Q5VT06|CE350_HUMAN Centrosome-associated protein 350 OS=Homo sapiens GN=CEP350 PE=1 SV=1 Back     alignment and function description
>sp|Q8N3C7|CLIP4_HUMAN CAP-Gly domain-containing linker protein 4 OS=Homo sapiens GN=CLIP4 PE=1 SV=1 Back     alignment and function description
>sp|Q01397|DYNA_NEUCR Dynactin, 150 kDa isoform OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-3 PE=3 SV=3 Back     alignment and function description
>sp|Q5R686|CLIP3_PONAB CAP-Gly domain-containing linker protein 3 OS=Pongo abelii GN=CLIP3 PE=2 SV=1 Back     alignment and function description
>sp|Q96DZ5|CLIP3_HUMAN CAP-Gly domain-containing linker protein 3 OS=Homo sapiens GN=CLIP3 PE=1 SV=3 Back     alignment and function description
>sp|Q9VJE5|CL190_DROME Restin homolog OS=Drosophila melanogaster GN=CLIP-190 PE=1 SV=1 Back     alignment and function description
>sp|Q20728|TBCB_CAEEL Tubulin-specific chaperone B OS=Caenorhabditis elegans GN=F53F4.3 PE=1 SV=1 Back     alignment and function description
>sp|Q54Z01|TBCB_DICDI Tubulin-specific chaperone B OS=Dictyostelium discoideum GN=tbcb PE=3 SV=1 Back     alignment and function description
>sp|O55156|CLIP2_RAT CAP-Gly domain-containing linker protein 2 OS=Rattus norvegicus GN=Clip2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
242020853 1814 conserved hypothetical protein [Pediculu 0.728 0.069 0.525 2e-38
189233780 1837 PREDICTED: similar to Kinesin-73 CG8183- 0.497 0.046 0.802 3e-37
270015064 1824 hypothetical protein TcasGA2_TC014226 [T 0.497 0.047 0.802 3e-37
328780639 1929 PREDICTED: kinesin 3A [Apis mellifera] 0.595 0.053 0.663 4e-36
383858251 2117 PREDICTED: kinesin-like protein KIF13B-l 0.549 0.044 0.69 5e-36
340719864 1905 PREDICTED: kinesin-like protein KIF13B-l 0.595 0.054 0.663 5e-36
307172257 1795 Kinesin-like protein KIF13A [Camponotus 0.728 0.070 0.489 7e-36
350416890 1909 PREDICTED: kinesin-like protein KIF13B-l 0.595 0.053 0.663 7e-36
195455370 1914 GK23204 [Drosophila willistoni] gi|19417 0.497 0.044 0.720 8e-36
380022445 1876 PREDICTED: kinesin-like protein KIF13B, 0.595 0.054 0.644 2e-35
>gi|242020853|ref|XP_002430865.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212516076|gb|EEB18127.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  163 bits (413), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 84/160 (52%), Positives = 104/160 (65%), Gaps = 34/160 (21%)

Query: 48   KVVRRKSSTRR---SSQSRASYPM---------------SGDQSFD-----------DVT 78
            KVV+RK +  +   ++  RAS+PM               +G +S +           D  
Sbjct: 1651 KVVKRKKTPSKGCSNNGHRASFPMVAPTLTESKAGNNLLNGSESIERLKNFFHADEVDAN 1710

Query: 79   LPEWVCIGESVLIRPYNSSGVIAYIGPTEFAAGTWVGVELDAPTGKNDGTVQGTRYFESR 138
            +P+WV +GESVLIRPYN+SGV+AY+G T+FA GTWVGVELDAPTGKNDG +QG RYF  +
Sbjct: 1711 VPDWVVVGESVLIRPYNTSGVVAYLGSTDFAPGTWVGVELDAPTGKNDGVIQGVRYFTCK 1770

Query: 139  PKHGIFVRADKLIQDRRGRAMRSGGT-----GAMRRSTSR 173
            PKHGIFVRADKLI D+RGRAMR          +MRRSTSR
Sbjct: 1771 PKHGIFVRADKLILDKRGRAMRQYKNMDQTEHSMRRSTSR 1810

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189233780|ref|XP_001814557.1| PREDICTED: similar to Kinesin-73 CG8183-PB [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270015064|gb|EFA11512.1| hypothetical protein TcasGA2_TC014226 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328780639|ref|XP_003249835.1| PREDICTED: kinesin 3A [Apis mellifera] Back     alignment and taxonomy information
>gi|383858251|ref|XP_003704615.1| PREDICTED: kinesin-like protein KIF13B-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340719864|ref|XP_003398365.1| PREDICTED: kinesin-like protein KIF13B-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307172257|gb|EFN63762.1| Kinesin-like protein KIF13A [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350416890|ref|XP_003491154.1| PREDICTED: kinesin-like protein KIF13B-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|195455370|ref|XP_002074692.1| GK23204 [Drosophila willistoni] gi|194170777|gb|EDW85678.1| GK23204 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|380022445|ref|XP_003695056.1| PREDICTED: kinesin-like protein KIF13B, partial [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
FB|FBgn00199681921 Khc-73 "Kinesin-73" [Drosophil 0.595 0.053 0.576 2.4e-29
UNIPROTKB|F1LRB41753 Kif13b "Protein Kif13b" [Rattu 0.514 0.050 0.459 7.5e-17
RGD|13033071767 Kif13b "kinesin family member 0.514 0.050 0.459 7.6e-17
UNIPROTKB|D4A9961827 Kif13b "Protein Kif13b" [Rattu 0.514 0.048 0.459 7.9e-17
UNIPROTKB|F1RJP91851 KIF13B "Uncharacterized protei 0.537 0.050 0.424 7.3e-16
UNIPROTKB|E1BGB01878 KIF13B "Uncharacterized protei 0.473 0.043 0.467 7.4e-16
UNIPROTKB|F1PIS81777 KIF13B "Uncharacterized protei 0.537 0.052 0.424 8.8e-16
UNIPROTKB|F1PIS51984 KIF13B "Uncharacterized protei 0.537 0.046 0.424 1e-15
UNIPROTKB|F8VPJ21826 KIF13B "Kinesin-like protein K 0.578 0.054 0.407 1.5e-15
UNIPROTKB|Q9NQT81826 KIF13B "Kinesin-like protein K 0.578 0.054 0.407 1.5e-15
FB|FBgn0019968 Khc-73 "Kinesin-73" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 341 (125.1 bits), Expect = 2.4e-29, P = 2.4e-29
 Identities = 60/104 (57%), Positives = 82/104 (78%)

Query:    71 DQSFD-DVTLPEWVCIGESVLIRPYNSSGVIAYIGPTEFAAGTWVGVELDAPTGKNDGTV 129
             ++S D ++ LPEW+ +GESVLIRPYN+SGVI ++G TEF  G W+GVELD PTGKNDG+V
Sbjct:  1792 EESKDVELVLPEWIVVGESVLIRPYNTSGVIRFVGTTEFQPGAWIGVELDTPTGKNDGSV 1851

Query:   130 QGTRYFESRPKHGIFVRADKLIQDRRGRAMRSGGTGAMRRSTSR 173
             +G +YF+ +PKHG+FVR+DKL+ D+RG+AMR+        S S+
Sbjct:  1852 KGVQYFQCKPKHGMFVRSDKLMLDKRGKAMRAYKAAEKSNSISK 1895
GO:0003777 "microtubule motor activity" evidence=ISS;IDA
GO:0008017 "microtubule binding" evidence=ISS
GO:0005871 "kinesin complex" evidence=ISS
GO:0007018 "microtubule-based movement" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0000235 "astral microtubule" evidence=IDA
GO:0051294 "establishment of spindle orientation" evidence=IMP
GO:0050803 "regulation of synapse structure and activity" evidence=IMP
GO:0035371 "microtubule plus end" evidence=IDA
GO:0042803 "protein homodimerization activity" evidence=IDA
GO:0005769 "early endosome" evidence=IDA
UNIPROTKB|F1LRB4 Kif13b "Protein Kif13b" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1303307 Kif13b "kinesin family member 13B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A996 Kif13b "Protein Kif13b" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RJP9 KIF13B "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BGB0 KIF13B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PIS8 KIF13B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PIS5 KIF13B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F8VPJ2 KIF13B "Kinesin-like protein KIF13B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NQT8 KIF13B "Kinesin-like protein KIF13B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
pfam0130267 pfam01302, CAP_GLY, CAP-Gly domain 3e-33
smart0105268 smart01052, CAP_GLY, Cytoskeleton-associated prote 2e-30
COG5244 669 COG5244, NIP100, Dynactin complex subunit involved 2e-16
>gnl|CDD|216424 pfam01302, CAP_GLY, CAP-Gly domain Back     alignment and domain information 
 Score =  112 bits (282), Expect = 3e-33
 Identities = 36/67 (53%), Positives = 44/67 (65%)

Query: 85  IGESVLIRPYNSSGVIAYIGPTEFAAGTWVGVELDAPTGKNDGTVQGTRYFESRPKHGIF 144
           +G+ V +      G + Y+GP  FA G WVGVELD P GKNDG+V G RYFE  PK+GIF
Sbjct: 1   VGDRVEVLGGGRRGTVRYVGPVPFAPGLWVGVELDEPRGKNDGSVDGVRYFECPPKYGIF 60

Query: 145 VRADKLI 151
           VR  K+ 
Sbjct: 61  VRPSKVE 67

Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network. A conserved motif, CAP-Gly, has been identified in a number of CAPs, including CLIP-170 and dynactins. The crystal structure of Caenorhabditis elegans F53F4.3 protein CAP-Gly domain was recently solved. The domain contains three beta-strands. The most conserved sequence, GKNDG, is located in two consecutive sharp turns on the surface, forming the entrance to a groove. Length = 67
>gnl|CDD|214997 smart01052, CAP_GLY, Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network Back     alignment and domain information
>gnl|CDD|227569 COG5244, NIP100, Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B [Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 173
PF0130269 CAP_GLY: CAP-Gly domain; InterPro: IPR000938 Cytos 99.94
KOG3206|consensus234 99.87
KOG0971|consensus 1243 99.79
COG5244 669 NIP100 Dynactin complex subunit involved in mitoti 99.78
KOG3207|consensus 505 99.67
KOG4568|consensus 664 99.61
KOG0241|consensus1714 99.58
KOG3556|consensus 724 99.24
KOG4568|consensus 664 99.08
PTZ00243 1560 ABC transporter; Provisional 94.03
PF1078162 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSR 92.87
PRK1070862 hypothetical protein; Provisional 92.53
PF0992653 DUF2158: Uncharacterized small protein (DUF2158); 85.42
>PF01302 CAP_GLY: CAP-Gly domain; InterPro: IPR000938 Cytoskeleton-associated proteins (CAP) are made of three distinct parts, an N-terminal section that is most probably globular and contains the CAP-Gly domain, a large central region predicted to be in an alpha-helical coiled-coil conformation and, finally, a short C-terminal globular domain Back     alignment and domain information 
Probab=99.94  E-value=8.6e-27  Score=164.53  Aligned_cols=67  Identities=57%  Similarity=1.093  Sum_probs=59.8

Q ss_pred             ccceEEEe-CCCceEEEEEEeecC-CCCceEEEEEEcCCCCCCCcEECCEEeeeeCCCCeeeEecCccc
Q psy3317          85 IGESVLIR-PYNSSGVIAYIGPTE-FAAGTWVGVELDAPTGKNDGTVQGTRYFESRPKHGIFVRADKLI  151 (173)
Q Consensus        85 VGdRV~V~-~~~~~GtVRYIG~l~-~~~GiwvGVELDep~GknDGtv~G~rYF~C~p~~GiFVk~~kV~  151 (173)
                      ||+||.|. .....|||||+|+++ +..|+|+|||||+|.|+|||+++|+|||+|+|+||+||++++|+
T Consensus         1 VG~rV~v~~~~~~~G~vryiG~~~~~~~g~~vGVEld~~~G~~dGt~~G~rYF~c~~~~G~Fv~~~~v~   69 (69)
T PF01302_consen    1 VGDRVRVDDPGGRRGTVRYIGPVPGFKSGIWVGVELDEPRGKNDGTVKGKRYFECPPNHGIFVRPSKVE   69 (69)
T ss_dssp             TTSEEEESSTTTEEEEEEEEEE-SSSSSSEEEEEEESSSTSSBSSEETTEESS-SSTTTEEEEEGGGE-
T ss_pred             CCCEEEEeeCCCCEEEEEEEeeCCCCCCCEEEEEEEcCCCCCCCcEECCEEEeeeCCCCEEEecHHHCC
Confidence            79999992 247999999999999 77889999999999999999999999999999999999999974

The CAP-Gly domain is a conserved, glycine-rich domain of about 42 residues found in some CAPs []. Proteins known to contain this domain include restin (also known as cytoplasmic linker protein-170 or CLIP-170), a 160 kDa protein associated with intermediate filaments and that links endocytic vesicles to microtubules; vertebrate dynactin (150 kDa dynein-associated polypeptide; DAP) and Drosophila glued, a major component of activator I; yeast protein BIK1, which seems to be required for the formation or stabilisation of microtubules during mitosis and for spindle pole body fusion during conjugation; yeast protein NIP100 (NIP80); human protein CKAP1/TFCB; Schizosaccharomyces pombe protein alp11 and Caenorhabditis elegans hypothetical protein F53F4.3. The latter proteins contain a N-terminal ubiquitin domain and a C-terminal CAP-Gly domain. The crystal structure of the CAP-Gly domain of C. elegans F53F4.3 protein, solved by single wavelength sulphur-anomalous phasing, revealed a novel protein fold containing three beta-sheets. The most conserved sequence, GKNDG, is located in two consecutive sharp turns on the surface, forming the entrance to a groove. Residues in the groove are highly conserved as measured from the information content of the aligned sequences. The C-terminal tail of another molecule in the crystal is bound in this groove []. ; PDB: 2CP6_A 2E4H_A 2E3H_A 3E2U_B 2HL3_B 3TQ7_Q 2HKQ_B 2HQH_A 2HKN_B 2HL5_C ....
>KOG3206|consensus Back     alignment and domain information
>KOG0971|consensus Back     alignment and domain information
>COG5244 NIP100 Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG4568|consensus Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>KOG3556|consensus Back     alignment and domain information
>KOG4568|consensus Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PF10781 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSRB is a novel dextransucrase which produces a dextran different from the typical dextran, as it contains (1-6) and (1-2) linkages, when this strain is grown in the presence of sucrose [] Back     alignment and domain information
>PRK10708 hypothetical protein; Provisional Back     alignment and domain information
>PF09926 DUF2158: Uncharacterized small protein (DUF2158); InterPro: IPR019226 This entry represents a family of predominantly prokaryotic proteins with no known function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
2cow_A100 Solution Structure Of The Cap-Gly Domain In Human K 2e-15
2cp6_A172 Solution Structure Of The 2nd Cap-Gly Domain In Hum 2e-14
2e4h_A98 Solution Structure Of Cytoskeletal Protein In Compl 2e-14
2e3h_A90 Crystal Structure Of The Clip-170 Cap-Gly Domain 2 3e-14
2cp3_A84 Solution Structure Of The 2nd Cap-Gly Domain In Hum 4e-14
2cp5_A141 Solution Structure Of The 1st Cap-Gly Domain In Hum 2e-13
2e3i_A86 Crystal Structure Of The Clip-170 Cap-Gly Domain 1 4e-13
2cp7_A84 Solution Structure Of The 1st Cap-Gly Domain In Mou 4e-13
3rdv_A72 Structure Of The Slain2c-Clipcg1 Complex Length = 7 5e-13
2cp0_A95 Solution Structure Of The 1st Cap-Gly Domain In Hum 5e-13
2coy_A112 Solution Structure Of The Cap-Gly Domain In Human D 7e-13
1txq_A93 Crystal Structure Of The Eb1 C-Terminal Domain Comp 8e-13
1whh_A102 Solution Structure Of The 2nd Cap-Gly Domain In Mou 8e-13
3tq7_P71 Eb1cEB3C HETERODIMER IN COMPLEX WITH THE CAP-Gly Do 9e-13
2hkn_A97 Crystal Structure Of The Cap-Gly Domain Of Human Dy 1e-12
2hl3_A97 Crystal Structure Of The A49m Mutant Cap-Gly Domain 2e-12
2qk0_A74 Structural Basis Of Microtubule Plus End Tracking B 2e-12
1tov_A98 Structural Genomics Of Caenorhabditis Elegans: Cap- 2e-12
1lpl_A95 Structural Genomics Of Caenorhabditis Elegans: Cap- 2e-12
1whk_A91 Solution Structure Of The 3rd Cap-Gly Domain In Mou 3e-12
2cp2_A95 Solution Structure Of The 1st Cap-Gly Domain In Hum 3e-12
1whg_A113 Solution Structure Of The Cap-Gly Domain In Mouse T 2e-11
4b6m_A84 Trypansoma Brucei Tubulin Binding Cofactor B Cap-Gl 4e-11
2coz_A122 Solution Structure Of The Cap-Gly Domain In Human C 4e-11
1whj_A102 Solution Structure Of The 1st Cap-Gly Domain In Mou 8e-11
2z0w_A96 Crystal Structure Of The 2nd Cap-Gly Domain In Huma 3e-10
>pdb|2COW|A Chain A, Solution Structure Of The Cap-Gly Domain In Human Kinesin- Like Protein Kif13b Length = 100 Back     alignment and structure 
Iteration: 1

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
Query: 79  LPEWVCIGESVLIRPYNSSGVIAYIGPTEFAAGTWVGVELDAPTGKNDGTVQGTRYFESR 138
           +PEW+  GE V +  + + GV+ Y+GP +F  GTWVGVELD P+GKNDG++ G +YF   
Sbjct: 20  VPEWLREGEFVTVGAHKT-GVVRYVGPADFQEGTWVGVELDLPSGKNDGSIGGKQYFRCN 78
Query: 139 PKHGIFVRADKL 150
           P +G+ VR  ++
Sbjct: 79  PGYGLLVRPSRV 90
>pdb|2CP6|A Chain A, Solution Structure Of The 2nd Cap-Gly Domain In Human Clip- 170RESTIN Length = 172 Back     alignment and structure
>pdb|2E4H|A Chain A, Solution Structure Of Cytoskeletal Protein In Complex With Tubulin Tail Length = 98 Back     alignment and structure
>pdb|2E3H|A Chain A, Crystal Structure Of The Clip-170 Cap-Gly Domain 2 Length = 90 Back     alignment and structure
>pdb|2CP3|A Chain A, Solution Structure Of The 2nd Cap-Gly Domain In Human Clip- 115CYLN2 Length = 84 Back     alignment and structure
>pdb|2CP5|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Human Clip- 170RESTIN Length = 141 Back     alignment and structure
>pdb|2E3I|A Chain A, Crystal Structure Of The Clip-170 Cap-Gly Domain 1 Length = 86 Back     alignment and structure
>pdb|2CP7|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Mouse Clip- 170RESTIN Length = 84 Back     alignment and structure
>pdb|3RDV|A Chain A, Structure Of The Slain2c-Clipcg1 Complex Length = 72 Back     alignment and structure
>pdb|2CP0|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Human Clip- 170-Related Protein Clipr59 Length = 95 Back     alignment and structure
>pdb|2COY|A Chain A, Solution Structure Of The Cap-Gly Domain In Human Dynactin 1 Length = 112 Back     alignment and structure
>pdb|1TXQ|A Chain A, Crystal Structure Of The Eb1 C-Terminal Domain Complexed With The Cap-Gly Domain Of P150glued Length = 93 Back     alignment and structure
>pdb|1WHH|A Chain A, Solution Structure Of The 2nd Cap-Gly Domain In Mouse Clip170-Related 59kda Protein Clipr-59 Length = 102 Back     alignment and structure
>pdb|3TQ7|P Chain P, Eb1cEB3C HETERODIMER IN COMPLEX WITH THE CAP-Gly Domain Of P150glued Length = 71 Back     alignment and structure
>pdb|2HKN|A Chain A, Crystal Structure Of The Cap-Gly Domain Of Human Dynactin-1 (P150- Glued) Length = 97 Back     alignment and structure
>pdb|2HL3|A Chain A, Crystal Structure Of The A49m Mutant Cap-Gly Domain Of Human Dynactin-1 (P150-Glued) In Complex With Human Eb1 C- Terminal Hexapeptide Length = 97 Back     alignment and structure
>pdb|2QK0|A Chain A, Structural Basis Of Microtubule Plus End Tracking By Xmap215, Clip-170 And Eb1 Length = 74 Back     alignment and structure
>pdb|1TOV|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Cap-Gly Domain Of F53f4.3 Length = 98 Back     alignment and structure
>pdb|1LPL|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Cap-Gly Domain Of F53f4.3 Length = 95 Back     alignment and structure
>pdb|1WHK|A Chain A, Solution Structure Of The 3rd Cap-Gly Domain In Mouse 1700024k14rik Hypothetical Protein Length = 91 Back     alignment and structure
>pdb|2CP2|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Human Clip- 115CYLN2 Length = 95 Back     alignment and structure
>pdb|1WHG|A Chain A, Solution Structure Of The Cap-Gly Domain In Mouse Tubulin Specific Chaperone B Length = 113 Back     alignment and structure
>pdb|4B6M|A Chain A, Trypansoma Brucei Tubulin Binding Cofactor B Cap-Gly Domain Length = 84 Back     alignment and structure
>pdb|2COZ|A Chain A, Solution Structure Of The Cap-Gly Domain In Human Centrosome-Associated Protein Cap350 Length = 122 Back     alignment and structure
>pdb|1WHJ|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Mouse 1700024k14rik Hypothetical Protein Length = 102 Back     alignment and structure
>pdb|2Z0W|A Chain A, Crystal Structure Of The 2nd Cap-Gly Domain In Human Restin- Like Protein 2 Reveals A Swapped-Dimer Length = 96 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
3rdv_A72 CAP-Gly domain-containing linker protein 1; cytosk 3e-33
1whk_A91 1700024K14RIK, riken cDNA 1700024K14; structural g 1e-32
2e3i_A86 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 3e-32
1txq_A93 Dynactin 1; protein complex, structural protein/pr 5e-32
1lpl_A95 Hypothetical 25.4 kDa protein F53F4.3 in chromosom 2e-31
2coy_A112 Dynactin-1; microtubule binding, cytoskeleton asso 3e-31
2cp3_A84 CLIP-115, KIAA0291; microtubule binding, cytoskele 4e-31
2cow_A100 Kinesin-like protein KIF13B; microtubule binding, 9e-31
2e3h_A90 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 1e-30
1whj_A102 1700024K14RIK, riken cDNA 1700024K14; structural g 2e-30
2cp2_A95 CLIP-115, KIAA0291; microtubule binding, cytoskele 3e-30
2z0w_A96 CAP-Gly domain-containing linker protein 4; altern 6e-30
2cp0_A95 Clipr-59 protein, clipr59; microtubule binding, cy 1e-29
1whh_A102 Clipr-59; microtubule binding, trans-golgi network 2e-29
2cp5_A141 Restin; microtubule binding, cytoskeleton associat 2e-28
1whg_A113 Tubulin specific chaperone B; microtubule binding, 4e-28
1ixd_A104 Cylindromatosis tumour-suppressor CYLD; structural 6e-28
2coz_A122 CAP350, centrosome-associated protein 350; microtu 7e-28
1whl_A95 Cylindromatosis tumor suppressor CYLD; deubiquitin 5e-24
2cp6_A172 Restin; microtubule binding, cytoskeleton associat 1e-21
1whm_A92 Cylindromatosis tumor suppressor CYLD; deubiquitin 2e-11
>3rdv_A CAP-Gly domain-containing linker protein 1; cytoskeletal protein, CAP Gly protein complex, structural PR; HET: BME; 1.75A {Homo sapiens} PDB: 2qk0_A Length = 72 Back     alignment and structure
 Score =  111 bits (281), Expect = 3e-33
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 81  EWVCIGESVLIRPYNSSGVIAYIGPTEFAAGTWVGVELDAPTGKNDGTVQGTRYFESRPK 140
           +   +GE V +   N  G I ++G T+FA G W G+ LD P GKNDG+V G RYF+  P 
Sbjct: 1   DDFRVGERVWVNG-NKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPL 59

Query: 141 HGIFVRADKL 150
            GIF R  KL
Sbjct: 60  KGIFTRPSKL 69
>1whk_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Length = 91 Back     alignment and structure
>2e3i_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 2.00A {Homo sapiens} SCOP: b.34.10.1 Length = 86 Back     alignment and structure
>1txq_A Dynactin 1; protein complex, structural protein/protein binding complex; 1.80A {Homo sapiens} SCOP: b.34.10.1 PDB: 2hqh_A 2hkq_B 2hkn_A 2pzo_A 3e2u_A 2hl5_C 2hl3_A 3tq7_P Length = 93 Back     alignment and structure
>1lpl_A Hypothetical 25.4 kDa protein F53F4.3 in chromosome V; structural genomics, CAP-Gly domain, cytoskeleton, tubulin, PSI; 1.77A {Caenorhabditis elegans} SCOP: b.34.10.1 PDB: 1tov_A Length = 95 Back     alignment and structure
>2coy_A Dynactin-1; microtubule binding, cytoskeleton associated protein, P150- glued, DAP-150, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 112 Back     alignment and structure
>2cp3_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 84 Back     alignment and structure
>2cow_A Kinesin-like protein KIF13B; microtubule binding, cytoskeleton associated protein, KIAA0639, kinesin-like protein gakin, structural genomics; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 100 Back     alignment and structure
>2e3h_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 1.45A {Homo sapiens} SCOP: b.34.10.1 PDB: 2e4h_A Length = 90 Back     alignment and structure
>1whj_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Length = 102 Back     alignment and structure
>2cp2_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 PDB: 2cp7_A Length = 95 Back     alignment and structure
>2z0w_A CAP-Gly domain-containing linker protein 4; alternative splicing, ANK repeat, protein binding, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 96 Back     alignment and structure
>2cp0_A Clipr-59 protein, clipr59; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 95 Back     alignment and structure
>1whh_A Clipr-59; microtubule binding, trans-golgi network, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: b.34.10.1 Length = 102 Back     alignment and structure
>2cp5_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 141 Back     alignment and structure
>1whg_A Tubulin specific chaperone B; microtubule binding, cytoskeleton associated protein, ckapi, structural genomics; NMR {Mus musculus} SCOP: b.34.10.1 Length = 113 Back     alignment and structure
>1ixd_A Cylindromatosis tumour-suppressor CYLD; structural genomics, riken structural genomics/proteomics initiative, RSGI, antitumor protein; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 104 Back     alignment and structure
>2coz_A CAP350, centrosome-associated protein 350; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 122 Back     alignment and structure
>1whl_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 95 Back     alignment and structure
>2cp6_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 172 Back     alignment and structure
>1whm_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 92 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
1ixd_A104 Cylindromatosis tumour-suppressor CYLD; structural 99.96
4b6m_A84 Tubulin-specific chaperone, putative; structural p 99.96
2e3i_A86 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 99.95
1lpl_A95 Hypothetical 25.4 kDa protein F53F4.3 in chromosom 99.95
3rdv_A72 CAP-Gly domain-containing linker protein 1; cytosk 99.95
2cp2_A95 CLIP-115, KIAA0291; microtubule binding, cytoskele 99.95
2cow_A100 Kinesin-like protein KIF13B; microtubule binding, 99.95
1txq_A93 Dynactin 1; protein complex, structural protein/pr 99.95
1whk_A91 1700024K14RIK, riken cDNA 1700024K14; structural g 99.95
1whh_A102 Clipr-59; microtubule binding, trans-golgi network 99.95
1whl_A95 Cylindromatosis tumor suppressor CYLD; deubiquitin 99.95
2e3h_A90 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 99.95
2cp3_A84 CLIP-115, KIAA0291; microtubule binding, cytoskele 99.95
2cp6_A172 Restin; microtubule binding, cytoskeleton associat 99.95
2z0w_A96 CAP-Gly domain-containing linker protein 4; altern 99.95
2coy_A112 Dynactin-1; microtubule binding, cytoskeleton asso 99.94
2cp0_A95 Clipr-59 protein, clipr59; microtubule binding, cy 99.94
1whj_A102 1700024K14RIK, riken cDNA 1700024K14; structural g 99.94
2cp5_A141 Restin; microtubule binding, cytoskeleton associat 99.94
1whg_A113 Tubulin specific chaperone B; microtubule binding, 99.94
2coz_A122 CAP350, centrosome-associated protein 350; microtu 99.94
1whm_A92 Cylindromatosis tumor suppressor CYLD; deubiquitin 99.92
>1ixd_A Cylindromatosis tumour-suppressor CYLD; structural genomics, riken structural genomics/proteomics initiative, RSGI, antitumor protein; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
Probab=99.96  E-value=3.8e-29  Score=189.12  Aligned_cols=80  Identities=30%  Similarity=0.442  Sum_probs=75.2

Q ss_pred             cccccceEEEeCC-CceEEEEEEeecCCCCceEEEEEE-cCCCCCCCcEECCEEeeeeCCCCeeeEecCcccccCCCccc
Q psy3317          82 WVCIGESVLIRPY-NSSGVIAYIGPTEFAAGTWVGVEL-DAPTGKNDGTVQGTRYFESRPKHGIFVRADKLIQDRRGRAM  159 (173)
Q Consensus        82 ~l~VGdRV~V~~~-~~~GtVRYIG~l~~~~GiwvGVEL-Dep~GknDGtv~G~rYF~C~p~~GiFVk~~kV~~d~~~~a~  159 (173)
                      .|+||+||.|... .++|||||||++++.+|+|+|||| |+|.|||||+++|+|||+|+|+||+||++++|..+.+|+++
T Consensus        17 ~l~VG~RV~V~~~~~~~GtVryvG~v~~~~G~wvGVEldDep~GKnDGsv~G~rYF~C~p~~G~FVr~~~v~~~~rf~~~   96 (104)
T 1ixd_A           17 GLEVGSLAEVKENPPFYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFASL   96 (104)
T ss_dssp             CCCTTSEEEECSSSCCCEEEEEEECCSSSCCCEEEEEESSCCTTCBSSEETTEECSCCCTTCBEEEEGGGEEECCTTCCC
T ss_pred             ccccCCEEEECcCCCcEEEEEEecccCCCCceEEEEEecCCCCCCCCCEECCEEeeecCCCcEEEEcHHHceeccccccC
Confidence            5899999999732 588999999999999999999999 89999999999999999999999999999999999999998


Q ss_pred             cC
Q psy3317         160 RS  161 (173)
Q Consensus       160 ~~  161 (173)
                      .+
T Consensus        97 ~~   98 (104)
T 1ixd_A           97 QP   98 (104)
T ss_dssp             CS
T ss_pred             CC
Confidence            54
>4b6m_A Tubulin-specific chaperone, putative; structural protein; 1.59A {Trypanosoma brucei} Back     alignment and structure
>2e3i_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 2.00A {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1lpl_A Hypothetical 25.4 kDa protein F53F4.3 in chromosome V; structural genomics, CAP-Gly domain, cytoskeleton, tubulin, PSI; 1.77A {Caenorhabditis elegans} SCOP: b.34.10.1 PDB: 1tov_A Back     alignment and structure
>3rdv_A CAP-Gly domain-containing linker protein 1; cytoskeletal protein, CAP Gly protein complex, structural PR; HET: BME; 1.75A {Homo sapiens} PDB: 2qk0_A Back     alignment and structure
>2cp2_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 PDB: 2cp7_A Back     alignment and structure
>2cow_A Kinesin-like protein KIF13B; microtubule binding, cytoskeleton associated protein, KIAA0639, kinesin-like protein gakin, structural genomics; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1txq_A Dynactin 1; protein complex, structural protein/protein binding complex; 1.80A {Homo sapiens} SCOP: b.34.10.1 PDB: 2hqh_A 2hkq_B 2hkn_A 2pzo_A 3e2u_A 2hl5_C 2hl3_A 3tq7_P Back     alignment and structure
>1whk_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>1whh_A Clipr-59; microtubule binding, trans-golgi network, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>1whl_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2e3h_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 1.45A {Homo sapiens} SCOP: b.34.10.1 PDB: 2e4h_A Back     alignment and structure
>2cp3_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2cp6_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2z0w_A CAP-Gly domain-containing linker protein 4; alternative splicing, ANK repeat, protein binding, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>2coy_A Dynactin-1; microtubule binding, cytoskeleton associated protein, P150- glued, DAP-150, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2cp0_A Clipr-59 protein, clipr59; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whj_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>2cp5_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whg_A Tubulin specific chaperone B; microtubule binding, cytoskeleton associated protein, ckapi, structural genomics; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>2coz_A CAP350, centrosome-associated protein 350; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whm_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 173
d2hqha172 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapien 4e-30
d2cowa188 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Hu 1e-29
d2e3ha171 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapien 6e-29
d2e3ia171 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) 1e-28
d1whka_91 b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse 8e-28
d1tova_98 b.34.10.1 (A:) Cytoskeleton-associated protein F53 2e-27
d2coza1109 b.34.10.1 (A:8-116) Centrosome-associated protein 2e-27
d2cp0a183 b.34.10.1 (A:7-89) CLIP170-related 59kda protein C 7e-27
d1whha_102 b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR 4e-25
d1whja_102 b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse 3e-24
d1ixda_104 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 6e-23
d1whga_113 b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1 1e-22
d1whma_92 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 3e-20
d1whla_95 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 2e-19
d2cp6a1160 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [ 4e-17
>d2hqha1 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: Cap-Gly domain
family: Cap-Gly domain
domain: Dynactin 1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  102 bits (257), Expect = 4e-30
 Identities = 33/66 (50%), Positives = 40/66 (60%)

Query: 85  IGESVLIRPYNSSGVIAYIGPTEFAAGTWVGVELDAPTGKNDGTVQGTRYFESRPKHGIF 144
           +G  V +      G +AY+G T FA G WVGV LD   GKNDGTVQG +YF     HGIF
Sbjct: 4   VGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIF 63

Query: 145 VRADKL 150
           VR  ++
Sbjct: 64  VRQSQI 69
>d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2e3ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2e3ia1 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1whka_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 91 Back     information, alignment and structure
>d1tova_ b.34.10.1 (A:) Cytoskeleton-associated protein F53F4.3 {Caenorhabditis elegans [TaxId: 6239]} Length = 98 Back     information, alignment and structure
>d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2cp0a1 b.34.10.1 (A:7-89) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1whja_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1whga_ b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 Back     information, alignment and structure
>d1whma_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1whla_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2cp6a1 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [TaxId: 9606]} Length = 160 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
d2hqha172 Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2cowa188 Kinesin-like protein kif13b {Human (Homo sapiens) 99.96
d2e3ha171 CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2e3ia171 Restin {Human (Homo sapiens) [TaxId: 9606]} 99.95
d2cp0a183 CLIP170-related 59kda protein CLIPR-59 (1500005P14 99.95
d1whha_102 CLIP170-related 59kda protein CLIPR-59 (1500005P14 99.95
d1whka_91 Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) 99.95
d2cp6a1160 Restin {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1ixda_104 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.95
d1whja_102 Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) 99.95
d2coza1109 Centrosome-associated protein 350 {Human (Homo sap 99.95
d1tova_98 Cytoskeleton-associated protein F53F4.3 {Caenorhab 99.94
d1whga_113 Tubulin-specific chaperone B (SKAP1) {Mouse (Mus m 99.94
d1whla_95 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.92
d1whma_92 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.91
>d2hqha1 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: Cap-Gly domain
family: Cap-Gly domain
domain: Dynactin 1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=9.2e-30  Score=179.88  Aligned_cols=70  Identities=47%  Similarity=0.836  Sum_probs=66.7

Q ss_pred             ccccceEEEeCCCceEEEEEEeecCCCCceEEEEEEcCCCCCCCcEECCEEeeeeCCCCeeeEecCcccc
Q psy3317          83 VCIGESVLIRPYNSSGVIAYIGPTEFAAGTWVGVELDAPTGKNDGTVQGTRYFESRPKHGIFVRADKLIQ  152 (173)
Q Consensus        83 l~VGdRV~V~~~~~~GtVRYIG~l~~~~GiwvGVELDep~GknDGtv~G~rYF~C~p~~GiFVk~~kV~~  152 (173)
                      |+||+||.|.....+|+|||+|++++.+|+|+|||||+|.|+|||+++|+|||+|+|+||+||++++|++
T Consensus         2 l~vG~rV~v~~~~~~G~vryvG~~~~~~g~~vGVeldep~GkndGt~~G~~YF~C~~~~G~Fv~~~~v~v   71 (72)
T d2hqha1           2 LRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQV   71 (72)
T ss_dssp             CSTTCEEEETTTCCEEEEEEEECCSSSSSCEEEEEESSSCSSBSSEETTEESSCCCTTTEEEECGGGEEE
T ss_pred             cccCCEEEEcCCCEEEEEEEecccCCCCCcEEEEEEccCCCCCCCEECCEEEEecCCCcEEEechHHEEE
Confidence            7899999997656889999999999999999999999999999999999999999999999999999875
>d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e3ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e3ia1 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cp0a1 b.34.10.1 (A:7-89) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whka_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cp6a1 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whja_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tova_ b.34.10.1 (A:) Cytoskeleton-associated protein F53F4.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1whga_ b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whla_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whma_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure