Diaphorina citri psyllid: psy333


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70
MAGQAGYSAYKYIPYGPVNEVLPYLSRRATENKGVLEKISKEKKLLRQEILRRIKSGKLFYTPKGHYTPI
ccccccccEEEECccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEECcccccccc
****AGYSAYKYIPYGPVNEVLPYLSRRATENKGVLEKISKEKKLLRQEILRRIKSGKLFYTPKGHY***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGQAGYSAYKYIPYGPVNEVLPYLSRRATENKGVLEKISKEKKLLRQEILRRIKSGKLFYTPKGHYTPI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Proline dehydrogenase 1, mitochondrial Converts proline to delta-1-pyrroline-5-carboxylate.confidentQ04499
Proline dehydrogenase 1, mitochondrial Converts proline to delta-1-pyrroline-5-carboxylate.confidentO45228
Proline dehydrogenase 1, mitochondrial Converts proline to delta-1-pyrroline-5-carboxylate.confidentQ86H28

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042331 [BP]phototaxisprobableGO:0040011, GO:0009628, GO:0042330, GO:0009605, GO:0009314, GO:0050896, GO:0009453, GO:0009416, GO:0008150
GO:0004657 [MF]proline dehydrogenase activityprobableGO:0003824, GO:0003674, GO:0016645, GO:0016491
GO:0007626 [BP]locomotory behaviorprobableGO:0044708, GO:0050896, GO:0008150, GO:0007610
GO:0008152 [BP]metabolic processprobableGO:0008150
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0071949 [MF]FAD bindingprobableGO:0043168, GO:0050662, GO:0050660, GO:0097159, GO:0043167, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:0000166, GO:1901363, GO:1901265

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HAZ, chain A
Confidence level:confident
Coverage over the Query: 2-39
View the alignment between query and template
View the model in PyMOL