Diaphorina citri psyllid: psy3348


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MFSGNQAWDQRFSIDLDKSRELEIGVYWRDWRSLCGVKFLRLEEFIDDIRHGMALQLEPQGLLFAEIKFLNPMISRKPKLQRQRKIFKQQGKNFPRANQMNINVATWGRLLKRSAPSIQNNRRPLPSLPHDAHSHSESPPNSEHYYD
ccccccccccEEEEECcccccEEEEEEEEccccccEEEEEEHHHHHHccccccEEEcccccEEEEEEEECcccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccc
*****QAWDQRFSIDLDKSRELEIGVYWRDWRSLCGVKFLRLEEFIDDIRHGMALQLEPQGLLFAEIKFLNPMIS***********************QMNINVATWGRLL************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSGNQAWDQRFSIDLDKSRELEIGVYWRDWRSLCGVKFLRLEEFIDDIRHGMALQLEPQGLLFAEIKFLNPMISRKPKLQRQRKIFKQQGKNFPRANQMNINVATWGRLLKRSAPSIQNNRRPLPSLPHDAHSHSESPPNSEHYYD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase N2 PKC-related serine/threonine-protein kinase and Rho/Rac effector protein that participates in specific signal transduction responses in the cell. Plays a role in the regulation of cell cycle progression, actin cytoskeleton assembly, cell migration, cell adhesion, tumor cell invasion and transcription activation signaling processes. Phosphorylates CTTN in hyaluronan-induced astrocytes and hence decreases CTTN ability to associates with filamentous actin. Phosphorylates HDAC5, therefore lead to impair HDAC5 import. Direct RhoA target required for the regulation of the maturation of primordial junctions into apical junction formation in bronchial epithelial cells. Required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner. Stimulates FYN kinase activity that is required for establishment of skin cell-cell adhesion during keratinocytes differentiation. Regulates epithelial bladder cells speed and direction of movement during cell migration and tumor cell invasion. Inhibits Akt pro-survival-induced kinase activity. Mediates Rho protein-induced transcriptional activation via the c-fos serum response factor (SRF).confidentQ8BWW9
Serine/threonine-protein kinase N2 PKC-related serine/threonine-protein kinase and Rho/Rac effector protein that participates in specific signal transduction responses in the cell. Plays a role in the regulation of cell cycle progression, actin cytoskeleton assembly, cell migration, cell adhesion, tumor cell invasion and transcription activation signaling processes. Phosphorylates CTTN in hyaluronan-induced astrocytes and hence decreases CTTN ability to associates with filamentous actin. Phosphorylates HDAC5, therefore lead to impair HDAC5 import. Direct RhoA target required for the regulation of the maturation of primordial junctions into apical junction formation in bronchial epithelial cells. Required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner. Stimulates FYN kinase activity that is required for establishment of skin cell-cell adhesion during keratinocytes differentiation. Regulates epithelial bladder cells speed and direction of movement during cell migration and tumor cell invasion. Inhibits Akt pro-survival-induced kinase activity. Mediates Rho protein-induced transcriptional activation via the c-fos serum response factor (SRF).confidentO08874
Serine/threonine-protein kinase N2 Pkc-related serine/threonine-protein kinase and Rho/Rac effector protein that participates in specific signal transduction responses in the cell. May play a role in the regulation of cell cycle progression, actin cytoskeleton assembly, cell migration, cell adhesion and transcription activation signaling processes.confidentA7MBL8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071320 [BP]cellular response to cAMPprobableGO:0070887, GO:0014074, GO:0044699, GO:0009719, GO:0051716, GO:1901698, GO:0071417, GO:0071310, GO:0014070, GO:0046683, GO:0071495, GO:0009987, GO:0051591, GO:0044763, GO:0042221, GO:0010033, GO:1901700, GO:1901701, GO:0071407, GO:0010243, GO:1901699, GO:0008150, GO:0050896
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:2000767 [BP]positive regulation of cytoplasmic translationprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010608, GO:0009891, GO:2000112, GO:0051247, GO:0051246, GO:0032270, GO:2000765, GO:0065007, GO:0045727, GO:0010468, GO:0060255, GO:0009889, GO:0050794, GO:0048518, GO:0008150, GO:0032268, GO:0010557, GO:0010556, GO:0006417, GO:0048522
GO:0050681 [MF]androgen receptor bindingprobableGO:0035258, GO:0035257, GO:0003674, GO:0005488, GO:0005515, GO:0051427, GO:0005102
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0030496 [CC]midbodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0032154 [CC]cleavage furrowprobableGO:0005575, GO:0044464, GO:0032153, GO:0032155, GO:0005623
GO:0035402 [MF]histone kinase activity (H3-T11 specific)probableGO:0035184, GO:0016773, GO:0016772, GO:0003824, GO:0016301, GO:0035173, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0010631 [BP]epithelial cell migrationprobableGO:0040011, GO:0032501, GO:0044707, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0051179, GO:0008150, GO:0001667, GO:0016477, GO:0090132, GO:0044699, GO:0090130
GO:0042826 [MF]histone deacetylase bindingprobableGO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0006972 [BP]hyperosmotic responseprobableGO:0008150, GO:0009628, GO:0006950, GO:0006970, GO:0050896
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0042393 [MF]histone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0017049 [MF]GTP-Rho bindingprobableGO:0019899, GO:0017016, GO:0031267, GO:0051020, GO:0003674, GO:0017048, GO:0005515, GO:0005488
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0007472 [BP]wing disc morphogenesisprobableGO:0048563, GO:0048569, GO:0009887, GO:0035220, GO:0009791, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0044767, GO:0008150, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731
GO:2000145 [BP]regulation of cell motilityprobableGO:0040012, GO:0050794, GO:0051270, GO:0065007, GO:0008150, GO:0032879, GO:0050789
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0048365 [MF]Rac GTPase bindingprobableGO:0019899, GO:0017016, GO:0031267, GO:0051020, GO:0003674, GO:0017048, GO:0005515, GO:0005488
GO:0035407 [BP]histone H3-T11 phosphorylationprobableGO:0018107, GO:0016310, GO:0018193, GO:0044699, GO:0016043, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018210, GO:0071704, GO:0016570, GO:0016572, GO:0006468, GO:0009987, GO:0006464, GO:0043412, GO:0035405, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0006796, GO:0036211, GO:0006793, GO:0044763, GO:0016568, GO:0016569
GO:0043296 [CC]apical junction complexprobableGO:0005575, GO:0030054, GO:0005911
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GMI, chain A
Confidence level:confident
Coverage over the Query: 5-71
View the alignment between query and template
View the model in PyMOL