Diaphorina citri psyllid: psy3349


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MDDKRFVGEVGLERWKELLRKNPERRLGSSERDAEDVKKQAFFRHIQWEELLHRRVKPPFVPTVTDVGDVSNFDEEFTSEKPELTPPKDPRPLTDDEQNLFKDFTYMADWC
ccccccccHHHHHHHHHHHccccccccccccccHHHHHHccccccccHHHHHccccccccccccccccccccccHHHcccccccccccccccccHHHHccccccEEEcccc
*DDKRFVGEVGLERWKELLRKNPERRLGSSERDAEDVKKQAFFRHIQWEELLHRRVKPPFVPTVTDVGDVSNFDEEFTSEKPELTPPK*********QNLFKDFTYMADWC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDKRFVGEVGLERWKELLRKNPERRLGSSERDAEDVKKQAFFRHIQWEELLHRRVKPPFVPTVTDVGDVSNFDEEFTSEKPELTPPKDPRPLTDDEQNLFKDFTYMADWC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase N2 PKC-related serine/threonine-protein kinase and Rho/Rac effector protein that participates in specific signal transduction responses in the cell. Plays a role in the regulation of cell cycle progression, actin cytoskeleton assembly, cell migration, cell adhesion, tumor cell invasion and transcription activation signaling processes. Phosphorylates CTTN in hyaluronan-induced astrocytes and hence decreases CTTN ability to associates with filamentous actin. Phosphorylates HDAC5, therefore lead to impair HDAC5 import. Direct RhoA target required for the regulation of the maturation of primordial junctions into apical junction formation in bronchial epithelial cells. Required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner. Stimulates FYN kinase activity that is required for establishment of skin cell-cell adhesion during keratinocytes differentiation. Regulates epithelial bladder cells speed and direction of movement during cell migration and tumor cell invasion. Inhibits Akt pro-survival-induced kinase activity. Mediates Rho protein-induced transcriptional activation via the c-fos serum response factor (SRF).confidentQ8BWW9
Serine/threonine-protein kinase N2 PKC-related serine/threonine-protein kinase and Rho/Rac effector protein that participates in specific signal transduction responses in the cell. Plays a role in the regulation of cell cycle progression, actin cytoskeleton assembly, cell migration, cell adhesion, tumor cell invasion and transcription activation signaling processes. Phosphorylates CTTN in hyaluronan-induced astrocytes and hence decreases CTTN ability to associates with filamentous actin. Phosphorylates HDAC5, therefore lead to impair HDAC5 import. Direct RhoA target required for the regulation of the maturation of primordial junctions into apical junction formation in bronchial epithelial cells. Required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner. Stimulates FYN kinase activity that is required for establishment of skin cell-cell adhesion during keratinocytes differentiation. Regulates epithelial bladder cells speed and direction of movement during cell migration and tumor cell invasion. Inhibits Akt pro-survival-induced kinase activity. Mediates Rho protein-induced transcriptional activation via the c-fos serum response factor (SRF).confidentO08874
Serine/threonine-protein kinase N2 PKC-related serine/threonine-protein kinase and Rho/Rac effector protein that participates in specific signal transduction responses in the cell. Plays a role in the regulation of cell cycle progression, actin cytoskeleton assembly, cell migration, cell adhesion, tumor cell invasion and transcription activation signaling processes. Phosphorylates CTTN in hyaluronan-induced astrocytes and hence decreases CTTN ability to associates with filamentous actin. Phosphorylates HDAC5, therefore lead to impair HDAC5 import. Direct RhoA target required for the regulation of the maturation of primordial junctions into apical junction formation in bronchial epithelial cells. Required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner. Stimulates FYN kinase activity that is required for establishment of skin cell-cell adhesion during keratinocytes differentiation. Regulates epithelial bladder cells speed and direction of movement during cell migration and tumor cell invasion. Inhibits Akt pro-survival-induced kinase activity. Mediates Rho protein-induced transcriptional activation via the c-fos serum response factor (SRF). Phosphorylates HCV NS5B leading to stimulation of HCV RNA replication.confidentQ16513

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051128 [BP]regulation of cellular component organizationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0018105 [BP]peptidyl-serine phosphorylationprobableGO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0040017 [BP]positive regulation of locomotionprobableGO:0048518, GO:0008150, GO:0040012, GO:0065007, GO:0050789
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0071320 [BP]cellular response to cAMPprobableGO:0070887, GO:0014074, GO:0044699, GO:0009719, GO:0051716, GO:1901698, GO:0071417, GO:0071310, GO:0014070, GO:0046683, GO:0071495, GO:0009987, GO:0051591, GO:0044763, GO:0042221, GO:0010033, GO:1901700, GO:1901701, GO:0071407, GO:0010243, GO:1901699, GO:0008150, GO:0050896
GO:0042393 [MF]histone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0048365 [MF]Rac GTPase bindingprobableGO:0019899, GO:0017016, GO:0031267, GO:0051020, GO:0003674, GO:0017048, GO:0005515, GO:0005488
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0043085 [BP]positive regulation of catalytic activityprobableGO:0019222, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789
GO:0007346 [BP]regulation of mitotic cell cycleprobableGO:0008150, GO:0050794, GO:0065007, GO:0050789, GO:0051726
GO:0006972 [BP]hyperosmotic responseprobableGO:0008150, GO:0009628, GO:0006950, GO:0006970, GO:0050896
GO:0010631 [BP]epithelial cell migrationprobableGO:0040011, GO:0032501, GO:0044707, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0051179, GO:0008150, GO:0001667, GO:0016477, GO:0090132, GO:0044699, GO:0090130
GO:0042826 [MF]histone deacetylase bindingprobableGO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0051239 [BP]regulation of multicellular organismal processprobableGO:0008150, GO:0065007, GO:0050789
GO:0045937 [BP]positive regulation of phosphate metabolic processprobableGO:0019220, GO:0009893, GO:0019222, GO:0010562, GO:0031323, GO:0050794, GO:0051174, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0031325, GO:0048522
GO:0009968 [BP]negative regulation of signal transductionprobableGO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0035407 [BP]histone H3-T11 phosphorylationprobableGO:0018107, GO:0016310, GO:0018193, GO:0044699, GO:0016043, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018210, GO:0071704, GO:0016570, GO:0016572, GO:0006468, GO:0009987, GO:0006464, GO:0043412, GO:0035405, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0006796, GO:0036211, GO:0006793, GO:0044763, GO:0016568, GO:0016569
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0007243 [BP]intracellular protein kinase cascadeprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0030496 [CC]midbodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0004697 [MF]protein kinase C activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0045787 [BP]positive regulation of cell cycleprobableGO:0051726, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0046328 [BP]regulation of JNK cascadeprobableGO:0070302, GO:0080134, GO:0080135, GO:0048583, GO:0050794, GO:0032872, GO:0009966, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0010627, GO:0050789, GO:0043408
GO:0032154 [CC]cleavage furrowprobableGO:0005575, GO:0044464, GO:0032153, GO:0032155, GO:0005623
GO:0033554 [BP]cellular response to stressprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0008150, GO:0044699
GO:0044448 [CC]cell cortex partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0035402 [MF]histone kinase activity (H3-T11 specific)probableGO:0035184, GO:0016773, GO:0016772, GO:0003824, GO:0016301, GO:0035173, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0071322 [BP]cellular response to carbohydrate stimulusprobableGO:1901700, GO:1901701, GO:0051716, GO:0009743, GO:0050896, GO:0009987, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0007281 [BP]germ cell developmentprobableGO:0032502, GO:0044702, GO:0048609, GO:0032504, GO:0022414, GO:0048869, GO:0032501, GO:0030154, GO:0048468, GO:0019953, GO:0044767, GO:0003006, GO:0048610, GO:0044763, GO:0044699, GO:0022412, GO:0008150, GO:0009987, GO:0000003, GO:0007276, GO:0048856
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0051346 [BP]negative regulation of hydrolase activityprobableGO:0051336, GO:0019222, GO:0050790, GO:0050789, GO:0065007, GO:0044092, GO:0008150, GO:0065009, GO:0043086
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:2000145 [BP]regulation of cell motilityprobableGO:0040012, GO:0050794, GO:0051270, GO:0065007, GO:0008150, GO:0032879, GO:0050789
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0043296 [CC]apical junction complexprobableGO:0005575, GO:0030054, GO:0005911
GO:0042981 [BP]regulation of apoptotic processprobableGO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0012505 [CC]endomembrane systemprobableGO:0005575, GO:0044464, GO:0005623
GO:0017049 [MF]GTP-Rho bindingprobableGO:0019899, GO:0017016, GO:0031267, GO:0051020, GO:0003674, GO:0017048, GO:0005515, GO:0005488
GO:0050681 [MF]androgen receptor bindingprobableGO:0035258, GO:0035257, GO:0003674, GO:0005488, GO:0005515, GO:0051427, GO:0005102
GO:2000767 [BP]positive regulation of cytoplasmic translationprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010608, GO:0009891, GO:2000112, GO:0051247, GO:0051246, GO:0032270, GO:2000765, GO:0065007, GO:0045727, GO:0010468, GO:0060255, GO:0009889, GO:0050794, GO:0048518, GO:0008150, GO:0032268, GO:0010557, GO:0010556, GO:0006417, GO:0048522

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A62, chain A
Confidence level:very confident
Coverage over the Query: 2-63
View the alignment between query and template
View the model in PyMOL
Template: 1O6L, chain A
Confidence level:very confident
Coverage over the Query: 2-83,98-110
View the alignment between query and template
View the model in PyMOL